MFSKKSYDGPPAGYGPPTGYGAPTADYGYGSPPPGSYYVDDAPQLFYKWTSPPGAVRGLQ AGVLVLCIAIFACVASTLAWDYGYGLGGAYGTGLGGFYGSNYYGSGLSYSYGYGGYYGGV NQRTANGFMIAMAVLCFLAQLGLLVAALSKSGATRSRRFYLAVLVLSAVLAFVMLIASIV YIMGVNPQAQMSSGYYYSPLLAMCSQAYGSTYLNQYIYHYCTVDPQEAVAAVCGFLIVIL LCLICFFAQKTRSKIWRYGKANIYWDRAPVVQEGPDVEEWVKNVADGASVQDETATLAYS EKPTSPVAAPPYSYVPPPSAGYYPSGTYSSRGDQPDRALSASPVHGEEEEEKGKDQPSRP PARRGRRRRRNPELDESQYETDYTTAVESSDERDQEQWASLYPPITSDGARQRYKQEFDT DLKRYKQLCAEMDSINDRLNQLSRRLDSITEDSPQYQDVAEEYNQLKDLKRSPDYQSKKQ ESKVLRNKLFHIKRMVSAYDKVRG
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
May play a role in the formation and regulation of the tight junction (TJ) paracellular permeability barrier. Interacts with ZO-1.
Gene References into Functions
the level of feed intake is related to or may directly regulate OCLN mRNA expression or may have an indirect effect through paracrine or autocrine factors in the ovary.PMID:28238709
Dietary Zn supplementation appeared to alleviate the loss of intestinal mucosal barrier function induced by S. Typhimurium challenge and the partial mechanism might be related to the increased expression of occludin and claudin-1 in broiler chickens.PMID:22834550
a unique motif in the occludin sequence that is involved in the regulation of ZO-1 binding by reversible phosphorylation of specific Tyr residues.PMID:19017651