Recombinant Chicken Occludin (OCLN)

Code: CSB-CF016263CH

Rate （N/A）
Review （0）

Size:

20μg100μg

US$6266

Quantity:

Express system: in vitro E.coli expression system

Species: Gallus gallus (Chicken)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

OCLN

Uniprot NO.

Q91049

Species

Gallus gallus (Chicken)

Source

in vitro E.coli expression system

Expression Region

1-504

Target Protein Sequence

MFSKKSYDGPPAGYGPPTGYGAPTADYGYGSPPPGSYYVDDAPQLFYKWTSPPGAVRGLQ AGVLVLCIAIFACVASTLAWDYGYGLGGAYGTGLGGFYGSNYYGSGLSYSYGYGGYYGGV NQRTANGFMIAMAVLCFLAQLGLLVAALSKSGATRSRRFYLAVLVLSAVLAFVMLIASIV YIMGVNPQAQMSSGYYYSPLLAMCSQAYGSTYLNQYIYHYCTVDPQEAVAAVCGFLIVIL LCLICFFAQKTRSKIWRYGKANIYWDRAPVVQEGPDVEEWVKNVADGASVQDETATLAYS EKPTSPVAAPPYSYVPPPSAGYYPSGTYSSRGDQPDRALSASPVHGEEEEEKGKDQPSRP PARRGRRRRRNPELDESQYETDYTTAVESSDERDQEQWASLYPPITSDGARQRYKQEFDT DLKRYKQLCAEMDSINDRLNQLSRRLDSITEDSPQYQDVAEEYNQLKDLKRSPDYQSKKQ ESKVLRNKLFHIKRMVSAYDKVRG
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

full length protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

May play a role in the formation and regulation of the tight junction (TJ) paracellular permeability barrier. Interacts with ZO-1.

Gene References into Functions

the level of feed intake is related to or may directly regulate OCLN mRNA expression or may have an indirect effect through paracrine or autocrine factors in the ovary. PMID:28238709
Dietary Zn supplementation appeared to alleviate the loss of intestinal mucosal barrier function induced by S. Typhimurium challenge and the partial mechanism might be related to the increased expression of occludin and claudin-1 in broiler chickens. PMID:22834550
a unique motif in the occludin sequence that is involved in the regulation of ZO-1 binding by reversible phosphorylation of specific Tyr residues. PMID:19017651

Hide All

Subcellular Location

Cell membrane; Multi-pass membrane protein. Cell junction, tight junction.

Protein Families

ELL/occludin family

Tissue Specificity

Localized at tight junctions of both epithelial and endothelial cells. Highly expressed in lung and liver. Expressed at a lower level in brain.

Database Links

UNIGENE: Gga.603

KEGG: gga:396026

Promotions