Home
Product
Protein
Transmembrane Proteins
Recombinant Chicken Gap junction alpha-1 protein (GJA1)

Recombinant Chicken Gap junction alpha-1 protein (GJA1)

Code: CSB-CF009443CH

Rate （N/A）
Review （0）

Size:

20μg100μg

US$5338

Quantity:

Express system: in vitro E.coli expression system

Species: Gallus gallus (Chicken)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

GJA1

Uniprot NO.

P14154

Alternative Names

GJA1; Gap junction alpha-1 protein; Connexin-43; Cx43

Species

Gallus gallus (Chicken)

Source

in vitro E.coli expression system

Expression Region

2-381

Target Protein Sequence

GDWSALGKLLDKVQAYSTAGGKVWLSVLFIFRILLLGTAVESAWGDEQSAFRCNTQQPGC ENVCYDKSFPISHVRFWVLQIIFVSVPTLLYLAHVFYVMRKEEKLNKREEELKVVQNDGV NVDMHLKQIESKKFKYGIEEHGKVKMRGGLLRTYIISILFKSVFEVAFLLIQWYIYGFSL SAIYTCERDPCPHRVDCFLSRPTEKTIFIVFMLVVSLVSLALNIIELFYVFFKGVKDRVK GKTDPYSHSGTMSPSKDCGSPKYAYYNGCSSPTAPLSPMSPPGYKLVTGDRNNSSCRNYN KQASEQNWANYSAEQNRMGQAGSTISNSHAQPFDFADEHQNTKKLASGHELQPLTIVDQR PPSRASSRASSRPRPDDLEI
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage Condition

Store at -20°C, for extended storage, conserve at -20°C or -80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell. Plays an essential role in gap junction communication in the ventricles.

Gene References into Functions

The present study describes four previously unknown SNPs, four haplotypes from two variants having high linkage disequilibrium, and seven diplotypes of the chicken GJA1 gene, and reports their significant association with growth traits. PMID:26782534
fluid flow shear stress induces the translocation of Cx43 to the membrane surface and unapposed hemichannels formed by Cx43 serve as a novel portal for the release of PGE2 in response to mechanical strain PMID:15843434
mechanotransduction occurs in individual cells but integration of signals markedly enhances it and (ii) communication via connexin 43 is inhibitory. PMID:16859807
Four percent of tenocytes had colocalization of actin filaments and Cx43, which was significantly increased with 5% cyclic strain PMID:17183550
Cell-cell communication among osteocytes in chick calvaria was mediated by Cx43 and was regulated by extracellular pH, extracellular calcium ion concentration, and PTH. PMID:17997713
that Cx43-hemichannel activity associated with PGE(2) release is adaptively regulated by mechanical loading to provide an effective means of regulating levels of extracellular signaling molecules responsible for initiation of bone (re)modeling. PMID:18676366