Recombinant Chicken Gap junction alpha-1 protein (GJA1)

Code: CSB-CF009443CH
Size:
20μg
20μg100μg
US$5338
Quantity:
Express system: in vitro E.coli expression system
Species: Gallus gallus (Chicken)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Target Names
GJA1
Uniprot NO.
Alternative Names
GJA1; Gap junction alpha-1 protein; Connexin-43; Cx43
Species
Gallus gallus (Chicken)
Source
in vitro E.coli expression system
Expression Region
2-381
Target Protein Sequence
GDWSALGKLLDKVQAYSTAGGKVWLSVLFIFRILLLGTAVESAWGDEQSAFRCNTQQPGC ENVCYDKSFPISHVRFWVLQIIFVSVPTLLYLAHVFYVMRKEEKLNKREEELKVVQNDGV NVDMHLKQIESKKFKYGIEEHGKVKMRGGLLRTYIISILFKSVFEVAFLLIQWYIYGFSL SAIYTCERDPCPHRVDCFLSRPTEKTIFIVFMLVVSLVSLALNIIELFYVFFKGVKDRVK GKTDPYSHSGTMSPSKDCGSPKYAYYNGCSSPTAPLSPMSPPGYKLVTGDRNNSSCRNYN KQASEQNWANYSAEQNRMGQAGSTISNSHAQPFDFADEHQNTKKLASGHELQPLTIVDQR PPSRASSRASSRPRPDDLEI
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell. Plays an essential role in gap junction communication in the ventricles.
Gene References into Functions
  1. The present study describes four previously unknown SNPs, four haplotypes from two variants having high linkage disequilibrium, and seven diplotypes of the chicken GJA1 gene, and reports their significant association with growth traits. PMID:26782534
  2. fluid flow shear stress induces the translocation of Cx43 to the membrane surface and unapposed hemichannels formed by Cx43 serve as a novel portal for the release of PGE2 in response to mechanical strain PMID:15843434
  3. mechanotransduction occurs in individual cells but integration of signals markedly enhances it and (ii) communication via connexin 43 is inhibitory. PMID:16859807
  4. Four percent of tenocytes had colocalization of actin filaments and Cx43, which was significantly increased with 5% cyclic strain PMID:17183550
  5. Cell-cell communication among osteocytes in chick calvaria was mediated by Cx43 and was regulated by extracellular pH, extracellular calcium ion concentration, and PTH. PMID:17997713
  6. that Cx43-hemichannel activity associated with PGE(2) release is adaptively regulated by mechanical loading to provide an effective means of regulating levels of extracellular signaling molecules responsible for initiation of bone (re)modeling. PMID:18676366

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, gap junction.
Protein Families
Connexin family, Alpha-type (group II) subfamily
Tissue Specificity
In all tissues, but mostly in lens.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products