Home
Product
Protein
Transmembrane Proteins
Recombinant Chicken Epidermal growth factor receptor (EGFR), partial

Recombinant Chicken Epidermal growth factor receptor (EGFR), partial

Code: CSB-CF007479CH

Rate （N/A）
Review （0）

Size:

20μg100μg

US$7530

Quantity:

Express system: in vitro E.coli expression system

Species: Gallus gallus (Chicken)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

EGFR

Uniprot NO.

P13387

Alternative Names

EGFR; Epidermal growth factor receptor; CER; Fragment

Species

Gallus gallus (Chicken)

Source

in vitro E.coli expression system

Expression Region

31-703

Target Protein Sequence

VEEKKVCQGTNNKLTQLGHVEDHFTSLQRMYNNCEVVLSNLEITYVEHNRDLTFLKTIQE VAGYVLIALNMVDVIPLENLQIIRGNVLYDNSFALAVLSNYHMNKTQGLRELPMKRLSEI LNGGVKISNNPKLCNMDTVLWNDIIDTSRKPLTVLDFASNLSSCPKCHPNCTEDHCWGAG EQNCQTLTKVICAQQCSGRCRGKVPSDCCHNQCAAGCTGPRESDCLACRKFRDDATCKDT CPPLVLYNPTTYQMDVNPEGKYSFGATCVRECPHNYVVTDHGSCVRSCNTDTYEVEENGV RKCKKCDGLCSKVCNGIGIGELKGILSINATNIDSFKNCTKINGDVSILPVAFLGDAFTK TLPLDPKKLDVFRTVKEISGFLLIQAWPDNATDLYAFENLEIIRGRTKQHGQYSLAVVNL KIQSLGLRSLKEISDGDIAIMKNKNLCYADTMNWRSLFATQSQKTKIIQNRNKNDCTADR HVCDPLCSDVGCWGPGPFHCFSCRFFSRQKECVKQCNILQGEPREFERDSKCLPCHSECL VQNSTAYNTTCSGPGPDHCMKCAHFIDGPHCVKACPAGVLGENDTLVWKYADANAVCQLC HPNCTRGCKGPGLEGCPNGSKTPSIAAGVVGGLLCLVVVGLGIGLYLRRRHIVRKRTLRR LLQERELVEPLTP
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Buffer

Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8

Storage Condition

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Shelf Life

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Receptor tyrosine kinase binding ligands of the EGF family and activating several signaling cascades to convert extracellular cues into appropriate cellular responses. Known ligands include EGF and TGFA/TGF-alpha. Ligand binding triggers receptor homo- and/or heterodimerization and autophosphorylation on key cytoplasmic residues. The phosphorylated receptor recruits adapter proteins like GRB2 which in turn activates complex downstream signaling cascades. Activates at least 4 major downstream signaling cascades including the RAS-RAF-MEK-ERK, PI3 kinase-AKT, PLCgamma-PKC and STATs modules. May also activate the NF-kappa-B signaling cascade.

Gene References into Functions

Epidermal growth factor receptor (EGFR) expression was significantly down-regulated after Marek's disease virus infection. The methylation level of the EGFR promoter was significantly increased at 21 days postinfection. PMID:23901748
Data suggest that a conserved mechanism involving EGFR signaling governs proliferation of auditory supporting cells in birds and mammals and may represent a target for future hair cell regeneration strategies. PMID:22230616
potential roles for epidermal growth factor receptor signaling in anterior-posterior and dorsal-ventral patterning, apical ectodermal ridges formation, and cell survival during limb morphogenesis PMID:15778992

Hide All

Subcellular Location

Cell membrane; Single-pass type I membrane protein. Endoplasmic reticulum membrane; Single-pass type I membrane protein. Golgi apparatus membrane; Single-pass type I membrane protein. Nucleus membrane; Single-pass type I membrane protein. Endosome. Endosome membrane. Nucleus.

Protein Families

Protein kinase superfamily, Tyr protein kinase family, EGF receptor subfamily

Database Links

UNIGENE: Gga.35024

KEGG: gga:396494

STRING: 9031.ENSGALP00000020165

Promotions