Recombinant Cat T-cell-specific surface glycoprotein CD28 (CD28)

Code: CSB-CF004913CA
Size:
20μg
20μg100μg
US$3998
Quantity:
Express system: in vitro E.coli expression system
Species: Felis catus (Cat) (Felis silvestris catus)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Target Names
CD28
Uniprot NO.
Alternative Names
CD28; T-cell-specific surface glycoprotein CD28; CD antigen CD28
Species
Felis catus (Cat) (Felis silvestris catus)
Source
in vitro E.coli expression system
Expression Region
21-221
Target Protein Sequence
KILVKQLPRLVVYNNEVNLSCKYTHNFFSKEFRASLYKGVDSAVEVCVVNGNYSHQPQFYSSTGFDCDGKLGNETVTFYLRNLFVNQTDIYFCKIEVMYPPPYIDNEKSNGTIIHVKEKHLCPAQLSPESSKPFWALVVVGGILGFYSLLATVALGACWMKTKRSRILQSDYMNMTPRRPGPTRRHYQPYAPARDFAAYRS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Involved in T-cell activation, the induction of cell proliferation and cytokine production and promotion of T-cell survival. Enhances the production of IL4 and IL10 in T-cells in conjunction with TCR/CD3 ligation and CD40L costimulation.
Subcellular Location
Membrane; Single-pass type I membrane protein.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products