Recombinant Cat Kit ligand (KITLG)

Code: CSB-CF012376CA

Rate （N/A）
Review （0）

Size:

20μg100μg

US$4358

Quantity:

Express system: in vitro E.coli expression system

Species: Felis catus (Cat) (Felis silvestris catus)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

KITLG

Uniprot NO.

P79169

Species

Felis catus (Cat) (Felis silvestris catus)

Source

in vitro E.coli expression system

Expression Region

26-274

Target Protein Sequence

KGLCRNRVTDDVKDVTKLVANLPKDYKIALKYVPGMDVLPSHCWISVMVEQLSVSLTDLLDKFSNISEGLSNYSIIDKLVKIVDDLVECVEGHSSENVKKSSKSPEPRLFTPEEFFRIFNRSIDAFKDLEMVASKTSECVVSSTLSPEKDSRVSVTKPFMLPPVAASSLRNDSSSSNRKATNPIEDSSIQWAVMALPACFSLVIGFAFGAFYWKKKQPNLTRTVENIQINEEDNEISMLQEKEREFQEV
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Stimulates the proliferation of mast cells. Able to augment the proliferation of both myeloid and lymphoid hematopoietic progenitors in bone marrow culture. Mediates also cell-cell adhesion. Acts synergistically with other cytokines, probably interleukins.

Gene References into Functions

In this study, we examined SCF expression in 23 samples of feline mast cell tumors (MCTs). SCF expression was detected in 10 cutaneous MCTs and a case of splenic mastocytosis. PMID:30213375
Results demonstrate that SCF promotes follicle development by upregulating c-kit mRNA expression and AKT phosphorylation. EGF suppresses the stimulating effect of SCF, leading to downregulation of FSHr expression. PMID:27279472

Hide All

Subcellular Location

[Isoform 1]: Cell membrane; Single-pass type I membrane protein. Secreted.; [Isoform 2]: Cytoplasm. Cytoplasm, cytoskeleton. Cell membrane; Single-pass type I membrane protein. Cell projection, lamellipodium. Cell projection, filopodium.; [Soluble KIT ligand]: Secreted.

Protein Families

SCF family

Database Links

KEGG: fca:493937

STRING: 9685.ENSFCAP00000020444

Promotions