CHHRICHCWHRVFLCQESKVTEIPSDLPRNAVELRFVLTKLRVIPKGAFSGFGDLEKIEI SQNDVLEVIEANVFFNLSKLHEIRIEKANNLLYIDTDAFQNLPNLRYLLISNTGIKHFPA VHKIQSLQKVLLDIQDNINIHTVERNSFMGLSFESMILWLNKNGIQEIHNCAFNGTQLDE LNLSDNINLEELPNDVFQGASGPVILDISRTRIHSLPSYGLENIKKLRAKSTYNLKKLPS LDKFVALMEASLTYPSHCCAFANWRRPISELHPICNKSILRQEVDDMTQARGQRVSLAED EESSYTKGFDMMYSEFDYDLCNEVVDVTCSPKPDAFNPCEDIMGYDILRVLIWFISILAI TGNIIVLMILITSQYKLTVPRFLMCNLAFADLCIGIYLLLIASVDIYTKSQYHNYAIDWQ TGAGCDAAGFFTVFASELSVYTLTVITLERWHTITHAMQLECKVQLRHAAIIMLLGWIFA FMVALFPIFGISSYMKVSICLPMDIDSPLSQLYVMSLLVLNVLAFVVICCCYAHIYLTVR NPNIVSSSSDTKIAKRMAMLIFTDFLCMAPISFFAISASLKVPLITVSKSKILLVLFYPI NSCANPFLYAIFTKNFRRDFFILLSKFGCYEVQAQTYRSETSSTAHNFHPRNGHCPPAPR VTNSSNYILIPLRHLAKN
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
G protein-coupled receptor for follitropin, the follicle-stimulating hormone. Through cAMP production activates the downstream PI3K-AKT and ERK1/ERK2 signaling pathways.
Gene References into Functions
No differences in the ovarian expression of FSHR mRNA, LHR protein or mRNA were found between the pre-pubertal and adult cats, but significantly lower FSHR protein expression was found in pre-pubertal cats compared to adult luteal cats.PMID:28402061
Results describe the expression of follicle stimulating hormone and luteinizing hormone receptors during follicular growth in the domestic cat ovary.PMID:17219419