All
  • All
  • ELISA Kit
  • Protein
  • Antibody
  • Molecular Biology Product
  • Small Molecule
All
  • All
  • ELISA Kit
  • Protein
  • Antibody
  • Molecular Biology Product
  • Small Molecule

Recombinant Bovine Vesicle-associated membrane protein-associated protein B (VAPB)

Code: CSB-CF025790BO
Size:
20μg
20μg100μg
US$4305
Quantity:
Express system: in vitro E.coli expression system
Species: Bos taurus (Bovine)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Target Names
VAPB
Uniprot NO.
A2VDZ9
Species
Bos taurus (Bovine)
Source
in vitro E.coli expression system
Expression Region
2-243
Target Protein Sequence
AKVEQVLSLEPQHELKFRGPFTDVVTTNLKLGNPTDRNVCFKVKTTAPRRYCVRPNSGIIDAGASINVSVMLQPFDYDPNEKSKHKFMVQSMFAPTDTSDMEAVWKEAKPEDLMDSKLRCVFELPAENDKPHDVEINKIIPTTASKTETPTVSKALSSSLDDTEVKKVMEECKRLQSEVQRLREENKQFKEEDGLRMRKTAQSNSPAPASAMAGKEEGLSTRLLALVVLFFIVGVIIGKIAL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Troubleshooting and FAQs
Protein FAQs
Datasheet & COA
Please contact us to get it.

Related Products

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)
Participates in the endoplasmic reticulum unfolded protein response (UPR) by inducing ERN1/IRE1 activity. Involved in cellular calcium homeostasis regulation.
Subcellular Location
Endoplasmic reticulum membrane; Single-pass type IV membrane protein.
Protein Families
VAMP-associated protein (VAP) (TC 9.B.17) family
Database Links
Promotions
Reward For Reviews
Free trial size antibodies
Contact Us

  Email: support@cusabio.com
  Distributors Worldwide

Service

Phage Display Service

Antibody Service

Protein Service

Gene Synthesis Service

Oligo Synthesis Service

Related Articles
CUSABIO's Five Expression SystemsHow to express a protein with bioactivity?How to choose a suitable expression vector?How to Choose the Right Recombinant Protein for Your Experimental Model?How to Properly Reconstitute Lyophilized Proteins?Verified vs. Unverified Recombinant Proteins: Making the Right Choice for Your ResearchApproaches to Determinate Protein ConcentrationExploring Protein-Protein Interactions: A Comprehensive Guide to Understanding and Utilizing ItWhat Is Protein Characterization: Definition, Examples, Methods, and TechniquesProtein Tags: A Comprehensive Overview
Related pathways
Cholesterol metabolism
CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of email
Email
support@cusabio.com
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Privacy Policy
▲ Select 0 Products