Home
Product
Protein
Transmembrane Proteins
Recombinant Bovine Vesicle-associated membrane protein 2 (VAMP2)

Recombinant Bovine Vesicle-associated membrane protein 2 (VAMP2)

Code: CSB-CF025781BO

Rate （N/A）
Review （0）

Size:

20μg100μg

US$3355

Quantity:

Express system: in vitro E.coli expression system

Species: Bos taurus (Bovine)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

VAMP2

Uniprot NO.

P63026

Alternative Names

VAMP2; SYB2; Vesicle-associated membrane protein 2; VAMP-2; Synaptobrevin-2

Species

Bos taurus (Bovine)

Source

in vitro E.coli expression system

Expression Region

2-116

Target Protein Sequence

SATAATAPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLKMMIILGVICAIILIIIIVYFSS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage Condition

Store at -20°C, for extended storage, conserve at -20°C or -80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Involved in the targeting and/or fusion of transport vesicles to their target membrane. Major SNARE protein of synaptic vesicles which mediates fusion of synaptic vesicles to release neurotransmitters. Essential for fast vesicular exocytosis and activity-dependent neurotransmitter release as well as fast endocytosis that mediates rapid reuse of synaptic vesicles. Modulates the gating characteristics of the delayed rectifier voltage-dependent potassium channel KCNB1.

Gene References into Functions

VAMP-2 is critical to lysosome fusion in membrane raft clustering, and this VAMP-2-mediated lysosome-MR signalosomes contribute to redox regulation of coronary endothelial function. PMID:21926345
VAMP2 is restricted from forming the SNARE (soluble N-ethylmaleimide-sensitive fusion protein attachment protein receptor) complex in chromaffin granules from adrenal medullae to the same degree as in brain-purified synaptic vesicles. PMID:14563208
Lengthening juxtamembrane region of synaptobrevin-2 severely reduced occurrence of rapid single events, leaving slow ones unchanged. It also impaired increase in fast-fusion mode that normally follows elevation of intracellular Ca2+ levels. PMID:18716205

Hide All

Subcellular Location

Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane; Single-pass type IV membrane protein. Cell membrane.

Protein Families

Synaptobrevin family

Database Links

UNIGENE: Bt.88332

KEGG: bta:282116

STRING: 9913.ENSBTAP00000005078

Promotions