Home
Product
Protein
Transmembrane Proteins
Recombinant Bovine Short transient receptor potential channel 6 (TRPC6)

Recombinant Bovine Short transient receptor potential channel 6 (TRPC6)

Code: CSB-CF865031BO

Rate （N/A）
Review （0）

Size:

20μg100μg

US$3160

Quantity:

Express system: in vitro E.coli expression system

Species: Bos taurus (Bovine)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

TRPC6

Uniprot NO.

Q9MYW0

Alternative Names

TRPC6; TRP6; Short transient receptor potential channel 6; TrpC6

Species

Bos taurus (Bovine)

Source

in vitro E.coli expression system

Expression Region

1-89

Target Protein Sequence

IFIMVFVAFMIGMFNLYSYYIGAKQNEAFTTVEESFKTLFWAIFGLSEVKSVVINYNHKF IENIGYVLYGVYNVTMVIVLLNMLIAMIN
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

full length protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage Condition

Store at -20°C, for extended storage, conserve at -20°C or -80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Thought to form a receptor-activated non-selective calcium permeant cation channel. Probably is operated by a phosphatidylinositol second messenger system activated by receptor tyrosine kinases or G-protein coupled receptors. Activated by diacylglycerol (DAG) in a membrane-delimited fashion, independently of protein kinase C. Seems not to be activated by intracellular calcium store depletion.

Gene References into Functions

These findings suggest that lysoPC induces CaM phosphorylation at Tyr(99) by a Src family kinase and that phosphorylated CaM activates PI3K to produce PIP3, which promotes TRPC6 translocation to the cell membrane. PMID:26858457
analysis of a TRPC6-TRPC5 channel cascade that restricts endothelial cell movement PMID:18495872

Hide All

Subcellular Location

Cell membrane; Multi-pass membrane protein.

Protein Families

Transient receptor (TC 1.A.4) family, STrpC subfamily, TRPC6 sub-subfamily

Database Links

UNIGENE: Bt.30924

KEGG: bta:407151

STRING: 9913.ENSBTAP00000053428

Promotions