SFFLRNSNDGYEQIPLPEDEDSSEGEFTEDRLSSGNRSSPPQKSPPGFISKSASGYLTSA WLTVFIPSVYTGVFLVSLPLNIMAVVVFVLKMKVKKPAVVYMLHLAAADVLFVCVLPFKI SYYFSGSDWRFGSAMCRFVTAAFYGNMYASIMLMTAISVDRFLAVVYPIQSLSWRTLGRA SFICLAIWAMAIAGVAPLLLQEQATQVPGLNITACHDVLNQTLLEGYYSYYFSAFSAVFF FVPLTLSTVSYVSIIRCLSSSTVANQNKKSRALLLSAAVFCIFILCFGPTNILLLLHYAF LSSDPMTEAAYFAYLLCVCVSSISCCIDPLIYYYASSECQRHLFAILHCKESSDPGSCNS SGQLMPSKMDTCSSNLSSSLYKKLLT
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
High affinity receptor for activated thrombin coupled to G proteins that stimulate phosphoinositide hydrolysis.
Gene References into Functions
MMP-1 promotes VEGFR2 expression and proliferation of endothelial cells through stimulation of PAR-1 and activation of NF-kappaBPMID:23155052
PAR1 and PAR2 regulate endothelial NO synthase phosphorylation and activity through G(12/13) and G(q), delineating the signaling pathways by which the proteases act on protease-activated receptors to modulate endothelial functions.PMID:19064814