Recombinant Bovine Oxytocin receptor (OXTR)

Code: CSB-CF017316BO

Rate （N/A）
Review （0）

Size:

20μg100μg

US$5420

Quantity:

Express system: in vitro E.coli expression system

Species: Bos taurus (Bovine)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

OXTR

Uniprot NO.

P56449

Alternative Names

OXTR; Oxytocin receptor; OT-R

Species

Bos taurus (Bovine)

Source

in vitro E.coli expression system

Expression Region

1-391

Target Protein Sequence

MEGAFAANWSAEAVNGSAAPPGTEGNRTAGPPQRNEALARVEVAVLCLILFLALSGNACV LLALRTTRHKHSRLFFFMKHLSIADLVVAVFQVLPQLLWDITFRFYGPDLLCRLVKYLQV VGMFASTYLLLLMSLDRCLAICQPLRSLSRRTDRLAVLVTWLGCLVASAPQVHIFSLREV ADGVFDCWAVFIQPWGPKAYITWITLAVYIVPVIVLATCYGLISFKIWQNLRLKTAAAAA EAAAGAEGEAADWAGRAILARVSNVKLISKAKIRTVKMTFIVVLAFIVCWTPFFFVQMWS VWDADAPKEASPFIIAMLLASLNSCCNPWIYMLFTGHLFQELVQRFLCCSFRRLKGSRPG ETSVSKKSNSSTFVLSQYSSSQRRCSQPSTL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

full length protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage Condition

Store at -20°C, for extended storage, conserve at -20°C or -80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Receptor for oxytocin. The activity of this receptor is mediated by G proteins which activate a phosphatidylinositol-calcium second messenger system.

Gene References into Functions

relationship between luteal concentrations of oxytocin (OT), noradrenaline (NA), progesterone (P4), oxytocin receptors (OT-R) and beta(2)-adrenoreceptors (beta(2)-R) gene expression and their protein level throughout the estrous cycle PMID:20149890
Components of the interferon system are found to significantly influence the transcription of the bovine oxytocin receptor gene. PMID:12604656
the presence of oxytocin receptors (OTR) in oviductal tissues is evident in the follicular phase cow PMID:12935872
These data show that E2 can stimulate PGF2 alpha secretion by increasing OXTR expression in bovine endometrial cells in vitro, but only after exposure to P4. PMID:12957670
study demonstrated that bovine lymphocytes express oxytocin receptors and that this expression can be regulated in a steroid-dependent manner PMID:18094352
Oxytocin receptor down-regulation is not necessary for reducing oxytocin-induced prostaglandin F(2alpha) accumulation by interferon-tau in a bovine endometrial epithelial cell line. PMID:18832100