Recombinant Bovine Oxidized low-density lipoprotein receptor 1 (OLR1)

Code: CSB-CF016331BO
Size:
20μg
20μg100μg
US$4515
Quantity:
Express system: in vitro E.coli expression system
Species: Bos taurus (Bovine)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Target Names
OLR1
Uniprot NO.
Species
Bos taurus (Bovine)
Source
in vitro E.coli expression system
Expression Region
1-270
Target Protein Sequence
MTVDDPKGMKDQLDQKPNGKTAKGFVSSWRWYPAAVTLGVLCLGLLVTVILLILQLSQVSDLIKKQQANITHQEDILEGQILAQRRSEKSAQESQKELKEMIETLAHKLDEKSKKLMELHRQNLNLQEVLKEAANYSGPCPQDWLWHEENCYQFSSGSFNWEKSQENCLSLDAHLLKINSTDELEFIQQMIAHSSFPFWMGLSMRKPNYSWLWEDGTPLTPHLFRIQGAVSRMYPSGTCAYIQRGTVFAENCILTAFSICQKKANLLRAQ
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Receptor that mediates the recognition, internalization and degradation of oxidatively modified low density lipoprotein (oxLDL) by vascular endothelial cells. OxLDL is a marker of atherosclerosis that induces vascular endothelial cell activation and dysfunction, resulting in pro-inflammatory responses, pro-oxidative conditions and apoptosis. Its association with oxLDL induces the activation of NF-kappa-B through an increased production of intracellular reactive oxygen and a variety of pro-atherogenic cellular responses including a reduction of nitric oxide (NO) release, monocyte adhesion and apoptosis. In addition to binding oxLDL, it acts as a receptor for the HSP70 protein involved in antigen cross-presentation to naive T-cells in dendritic cells, thereby participating in cell-mediated antigen cross-presentation. Also involved in inflammatory process, by acting as a leukocyte-adhesion molecule at the vascular interface in endotoxin-induced inflammation. Also acts as a receptor for advanced glycation end (AGE) products, activated platelets, monocytes, apoptotic cells and both Gram-negative and Gram-positive bacteria.
Gene References into Functions
  1. Endothelial LOX-1 overexpression in an atherosclerosis-prone LDL receptor knockout mice impairs endothelial function, proving its importance in the development of atherosclerosis. PMID:29096854
  2. bta-miR-370 has a negative regulatory effect on the OLR1 gene at both the gene and protein expression levels and has a role in lipid metabolism in bovine adipocytes PMID:28294375
  3. Overexpression of LOX-1 leads to the attenuation of protective autophagy response in aortic endothelial cells. PMID:25703423
  4. These results imply that the 3' UTR SNP of the OLR1 gene is a strong candidate marker for selection in cattle breeding programs. PMID:23910552
  5. Our data indicate that blocking the LOX-1 receptor signal pathway might be a promising way to improve steroid hormone concentrations in metabolically highly active female mammals PMID:24115745
  6. In the present study, we show that inhibition of LOX-1 leads to a rearrangement of ceramide from the basal membrane toward the Golgi apparatus PMID:24710763
  7. The downregulation of eNOS by ox-low-density lipoprotein, as driven by LOX-1-mediated endoplasmic stress, is associated with the PI3K-Akt-eNOS signaling pathway. PMID:24085225
  8. 3'-UTR SNP assoicated with milk composition traits and somatic cell score PMID:22365237
  9. Disruption of lipid packing of cholesterol-rich membrane domains plays a key role in oxidized low-density lipoprotein (oxLDL)-induced changes in endothelial biomechanics. PMID:20410437
  10. Oxidized low-density lipoprotein receptor (OLR1) single nucleotide polymorphism haplotype is associated with milk fat yield and fat percentage PMID:16606746
  11. synergistic effects of cyclic tensile stretch load and ox-LDL on cell viability and proteoglycan synthesis in chondrocytes, which may be mediated through enhanced expression of LOX-1 PMID:16795046
  12. Upregulates VEGF expression in articular cartilage, at least in part, through activation of PPAR-gamma. PMID:16904074
  13. Mediation of electronegative low-density lipoprotein signaling by LOX-1: a possible mechanism of endothelial apoptosis. PMID:19150883
  14. ox-LDL binding to LOX-1 induces stress-induced senescence of chondrocytes and suppression of telomerase activity. Oxidized LDL may play an important role in the pathogenesis of osteoarthritis by inducing chondrocyte senescence. PMID:19790061

Show More

Hide All

Subcellular Location
Cell membrane; Lipid-anchor. Cell membrane; Single-pass type II membrane protein. Membrane raft. Secreted.
Tissue Specificity
Highly expressed in endothelial cells, aortic intima and lung. Expressed at low level in other tissues.
Database Links

UNIGENE: Bt.367

KEGG: bta:281368

STRING: 9913.ENSBTAP00000005975

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products