Home
Product
Protein
Transmembrane Proteins
Recombinant Bovine Mitochondrial brown fat uncoupling protein 1 (UCP1)

Recombinant Bovine Mitochondrial brown fat uncoupling protein 1 (UCP1)

Code: CSB-CF025554BO

Rate （N/A）
Review （0）

Size:

20μg100μg

US$4649

Quantity:

Express system: in vitro E.coli expression system

Species: Bos taurus (Bovine)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

UCP1

Uniprot NO.

P10861

Alternative Names

UCP1; SLC25A7; UCP; Mitochondrial brown fat uncoupling protein 1; UCP 1; Solute carrier family 25 member 7; Thermogenin

Species

Bos taurus (Bovine)

Source

in vitro E.coli expression system

Expression Region

1-288

Target Protein Sequence

IFSAGVAACVADIITFPLDTAKVRLQIQGECLISSAIRYKGVLGTIITLAKTEGPVKLYS GLPAGLQRQISLASLRIGLYDTVQEFFTTGKEASLGSKISAGLMTGGVAVFIGQPTEVVK VRLQAQSHLHGPKPRYTGTYNAYRIIATTEGLTGLWKGTSPNLTTNVIINCTELVTYDLM KEALVKNKLLADDVPCHFVSAVVAGFCTTVLSSPVDVVKTRFVNSSPGQNTSVPNCAMMM LTREGPSAFFKGFVPSFLRLGSWNIMFVCFERLKQELMKCRHTMDCAT
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

Full length protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage Condition

Store at -20°C, for extended storage, conserve at -20°C or -80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Mitochondrial protein responsible for thermogenic respiration, a specialized capacity of brown adipose tissue and beige fat that participates in non-shivering adaptive thermogenesis to temperature and diet variations and more generally to the regulation of energy balance. Functions as a long-chain fatty acid/LCFA and proton symporter, simultaneously transporting one LCFA and one proton through the inner mitochondrial membrane. However, LCFAs remaining associated with the transporter via their hydrophobic tails, it results in an apparent transport of protons activated by LCFAs. Thereby, dissipates the mitochondrial proton gradient and converts the energy of substrate oxydation into heat instead of ATP. Regulates the production of reactive oxygen species/ROS by mitochondria.

Gene References into Functions

The results of the present study provide an insight into the unexpected expression of Ucp1 in bovine skeletal muscle, which suggests the necessity for further studies on Ucp1-mediated energy expenditure in bovine skeletal muscle. PMID:28046166
study suggests that uncoupling protein 1 affects milk yield, milk fat percentage and milk protein percentage PMID:27691991
UCPs do have uncoupling properties when expressed in mitochondria but that uncoupling by UCP1 or UCP2 does not prevent acute substrate-driven endothelial cell superoxide as effluxed from mitochondria respiring in vitro. PMID:15339748
These results suggest that CIDE-A and UCP1 are regulated by insulin and/or fatty acids in mammary epithelial cells and lactating mammary glands, and thereby play an important role in lipid and energy metabolism. PMID:19427838