LRPAPCPEPCSCPPDGALRCPGPQAGLSRLSLTYLPIKVIPSQAFRGLNEVIKIEISQSD SLEKIEANAFDNLLNLSEILIQNTKNLVHIEAGAFTNLPRLKYLSICNTGIHKLPDVTKI FSSEFNFILEICDNLHITTIPRNAFQGMNNESITLKLYGNGFEEIQSHAFNGTTLISLEL KENARLEKMHNDAFRGATGPSILDISSTKLQALPTYGLESIQTLIATSSYSLKKLPSREK FTNLLDATLTYPSHCCAFRNLPTNEQNFSFSIFKNFSKQCESTARRPNNETLYSAIFAES ELSGWDYDYGFCLPKTLQCAPEPDAFNPCEDIMGYNFLRVLIWLINILAITGNVTVLFVL LTSRYKLTVPRFLMCNLSFADFCMGLYLLLIASVDAQTKGQYYNHAIDWQTGSGCSAAGF FTVFASELSVYTLTVITLERWHTITYAIQLDQKLRLKHAIPVMLGGWLFSTLIAVLPLVG VSNYMKVSICLPMDVESTLSQVYILTILILNVMAFIIICACYIKIYFAVQNPELMATNKD TKIAKKMAVLIFTDFTCMAPISFFAISAAFKVPLITVTNSKVLLVLFYPVNSCANPFLYA IFTKAFQRDFFLLLSKFGCCKYRAELYRRKDFSAYISNCKNGFTGSNKPSRSTFKLTTLQ CQYSAVLDKTCYKEC
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Receptor for lutropin-choriogonadotropic hormone. The activity of this receptor is mediated by G proteins which activate adenylate cyclase.
Gene References into Functions
large numbers of unknown LH-regulated granulosa cell genes are identified and their putative roles in ovarian function, are reported.PMID:23716604
Gene expression of granulosa cells reveals that 747 transcripts are potentially regulated by LH.PMID:28840634
The outcomes of the present study support a dynamic multi-facetted regulation of LHR during pre-translation.PMID:26507944
expression of LHR mRNA in bovine granulosa cells is established after follicle deviation, and the lower abundance of LRBP mRNA after the expected time of deviation may contribute to greater expression of LHR in the bovine dominant folliclePMID:26446749
These results suggested an acute regulation of INSL3 by luteinizing hormone (LH) because INSL3 concentrations increased immediately after endogenous and exogenous LH stimulation.PMID:26318230
INVESTIGATION OF STAT5A, FSHR AND LHR GENE POLYMORPHISMS IN TURKISH INDIGENOUS CATTLE BREEDSPMID:26845856
These findings strongly support the concept that IGF-1 upregulates LHR expression in granulosa cells and that IGF-1 is required for determining which follicle becomes dominant and acquires ovulatory capacity.PMID:25626338
LHCGR mRNA expression in granulosa cells was significantly higher in large antral follicles than in cysts, and not detected in granulosa cells of small and medium antral follicles.PMID:25454493
The luteinizing hormone receptor [LHR] splicing pattern is complex in bovine Leydig cells, and expression of full-length LHR and isoforms A and B changes when induced with LH.PMID:22843048
Significant correlations were found between sperm quality parameters and polymorphisms in the luteinizing hromoe receptor gene in Chinese Holstein bulls.PMID:22327646
The LHCGR gene is a potential marker for superovulation response and can be used to predict the most appropriate dose of FSH for superovulation in Chinese Holstein cows.PMID:21667104
Dominant follicles experience a reduction in FSH dependence (diminished expression of FSHR), but acquire increased LH dependence (enhanced expression of LHCGR) as they grow during the low FSH milieu of follicular waves.PMID:16481595
Three single nucleotide polymorphisms in LHCGR were significantly associated with variations in cattle fertility and production traits.PMID:17121604
Granulosa cells do not acquire functional LHR until follicle dominance occurs.PMID:17154302
Heterozygous heifers showed a higher pregnancy rate (67 and 66% for LHR and FSHR genes, respectively), but no significant effects were observed for the genes studied (PMID:18393228
Differential expression of LHRH-receptor in bovine nasal tissue and its role in deslorelin deliveryPMID:18992782