Recombinant Bovine L-selectin (SELL)

Code: CSB-CF020977BO

Rate （N/A）
Review （0）

Size:

20μg100μg

US$4979

Quantity:

Express system: in vitro E.coli expression system

Species: Bos taurus (Bovine)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

SELL

Uniprot NO.

P98131

Species

Bos taurus (Bovine)

Source

in vitro E.coli expression system

Expression Region

39-370

Target Protein Sequence

WTYHYSKRPMPWEKARAFCRENYTDLVAIQNKGEIEYLNKTLPFSRTYYWIGIRKVEGVWTWVGTNKSLTEEAKNWGAGEPNNRKSKEDCVEIYIKRNKDSGKWNDDACHKAKTALCYTASCKPWSCSGHGQCVEVINNYTCNCDLGYYGPECQFVTQCVPLEAPKLGTMACTHPLGNFSFMSQCAFNCSKGTDMIGVEETTCAPFGNWSSPEPTCRVIQCEPLTEPDLGTMDCNHPLVDFGFSSTCTFSCSEEAELTGEKKTICGLSGNWSSPSPRCQKINRTISINEESDYNPLFIPVAVMVTAFSGLAFIIWLARRLKRKSKKVSEKHG
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Calcium-dependent lectin that mediates cell adhesion by binding to glycoproteins on neighboring cells. Mediates the adherence of lymphocytes to endothelial cells of high endothelial venules in peripheral lymph nodes. Promotes initial tethering and rolling of leukocytes in endothelia.

Gene References into Functions

Five single nucleotide polymorphisms (SNPs) from different exons in selectin SELP, two in selectin SELL and one in selectin SELE were taken forward to genotyping in 337 Holstein Friesian heifers using PCR-RFLP. PMID:28419109
gammadelta T cells, the main recirculating subset in both afferent and efferent lymph, have high levels of CD62L cell surface expression. PMID:22156593
demonstrate the existence of central memory T cells (Tcm) in cattle and suggest that CD62L may serve as a marker to monitor Tcm in infections and vaccine development studies in ruminant. PMID:19766669
determined the effects of Mycobacterium-induced proliferation and apoptosis on CD25, CD44, and CD62L expression on peripheral blood T-cell subsets from M. bovis-infected cattle PMID:12496181
intramammarily administered lipopolysaccharides seem to play an important role in modulating L-selectin and beta2 integrin expression on circulating bovine polymorphonuclear leukocytes PMID:12906050
results indicate that glucocorticoid-induced suppression of L-selectin is likely mediated by direct effects of glucocorticoid receptor activation on intracellular reservoirs of L-selectin mRNA and protein, predominantly in blood neutrophils. PMID:14761937