FSGSEATPAFLVRASQSLQILYPVLETNSSGNPKFTKCRSPELETFSCHWTDGANHSLQSPGSVQMFYIRRDIQEWKECPDYVSAGENSCYFNSSYTSVWTPYCIKLTSNGGIVDHKCFSVEDIVQPDPPVGLNWTLLNISLTEIHADILVKWEPPPNTDVKMGWIILEYELHYKELNETQWKMMDPLMVTSVPMYSLRLDKEYEVRVRTRQRNTEKYGKFSEVLLITFPQMNPSACEEDFQFPWFLIIIFGILGLAVTLYLLIFSKQQRIKMLILPPVPVPKIKGIDPDLLKEGKLEEVNTILAIHDNYKHEFYNDDSWVEFIELDIDDPDEKTEGSDTDRLLSNDHEKSLNIFGAKDDDSGRTSCYEPDILEADFHVSDMCDGTSEVAQPQRLKGEADISCLDQKNQNNSPSNDAAPASQQPSVILVEENKPRPLLIGGTESTHQAVHTQLSNPSSLANIDFYAQVSDITPAGNVVLSPGQKNKTGNPQCDTHPEVVTPCQANFIVDNAYFCEVDAKKYIALAPHVEAESHVEPSFNQEDIYITTESLTTTAGRSGTAEHVPSSEIPVPDYTSIHIVQSPQGLVLNATALPLPDKEFLSSCGYVSTDQLNKIMP
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Receptor for pituitary gland growth hormone involved in regulating postnatal body growth. On ligand binding, couples to, and activates the JAK2/STAT5 pathway.; The soluble form (GHBP) acts as a reservoir of growth hormone in plasma and may be a modulator/inhibitor of GH signaling.
Gene References into Functions
Most heifer reproductive traits were not significantly affected by CAST and CAPN1 markers that are widely used to improve beef tenderness by selection and breeders should not be concerned with how these markers affect reproduction and other heifer traits with the possible exception of CAPN1 effects on calving date.PMID:29448132
There was no association between the genotypes of GH and IGF-IS and fertility of Holstein cows raised in semiextensive or intensive regimes, while the STAT5 ABstEII polymorphism was associated with calving-first heat interval in Holstein cows raised in the intensive system.PMID:27865414
hepatic growth hormone receptor and suppressor of cytokine signaling (SOCS)2 messenger RNA expression appeared to be promptly and sensitively regulated by increased estradiol levels before ovulation of dairy heifersPMID:25704974
Comparatively studied genetic diversity of growth hormone receptor (GHR) in Tibetan cattle and Chinese Holstein cow.PMID:25927168
This work confirms the importance of CAPN1 and CAST for tenderness in beef, provides a new effect of CAST on beef tenderness, and questions the utility of GHR as a selection marker for beef quality.PMID:24398843
the data support the high potential of the growth hormone receptor F279Y polymorphism as a marker for the improvement of milk traits in selection programsPMID:21660490
6 of the published GHR SNPs and 7 of the novel GHR SNPs were associated with at least 1 of the traits--milk yield, fat yield, protein yield, fat percentage, protein percentage, somatic cell score, calving interval, survival and growth and size traits.PMID:20528848
Effects of GHR p.Phe279Tyr mutations on milk, fat and protein yield, as well as fat and protein percentage in the milk of 1222 Holstein cows was found to be significantly associated with protein percentage.PMID:19781040
Food deprivation-induced decrease in circulating IGF-I in steers is associated with decrease in expression of different IGF-I mRNA variants and specific decrease in expression of growth hormone receptor mRNA variants 1C3 and 1A in liver.PMID:12888636
Insulin regulates the efficiency of GH signaling in liver and adipose tissue of dairy cows by acting as a rheostat of GHR synthesis.PMID:15113939
Results show that chicken ovalbumin upstream promoter transcription factor II (COUP-TFII), hepatocyte nuclear factor 4alpha (HNF-4alpha) and HNF-4gamma regulate growth hormone receptor 1A promoter activity by binding to a common DNA elementPMID:15171724
allele and genotype frequencies of microsatellite markers located in the 5'-regulatory region of the IGF1 and GHR genes in beef cattle and effects of these markers on growth and carcass traits in an intensive production systemPMID:15670132
molecular evolution of GHR in the BovidaePMID:17044257
Polymorphism in exon 10 of growth hormone receptor (GHR) was found to play a role in body weight determination in three cattle breeds. Results indicated that there were six genotypes, namely AA, BB, CC, AB, AC and BC.PMID:17369175
FSH, but not E2, stimulated the expression of IR and GHR genes during follicular development.PMID:17507188
Single base substitution in the transmembrane domain encoding region of GH receptor gene may influence the physiological properties of the receptor.PMID:17693965
The effect of single nucleotide polymorphisms in 6 genes and their associations with production factors in beef cattle are reported.PMID:17785604
single nucleotide polymorphisms in GHR significantly affected feed intake, feed conversion, and body energy traitsPMID:18650297
Nine single nucleotide polymorphisms were identified.PMID:18676722
DGAT1 and growth hormone receptor alleles whichor increase in milk production were found to have an adverse effect on reproduction, while the leptin allele responsible for increase in milk production was linked to marginally increased metritis frequency.PMID:18822099
Results indicate that the effects of polymorphism in ghr genes on cattle milk or meat production traits could be at least partially mediated through their effects on the igf1 gene expression in the liver and the IGF1 level in blood.PMID:19112400
Show
More
Hide
All
Subcellular Location
Cell membrane; Single-pass type I membrane protein.; [Growth hormone-binding protein]: Secreted.
Protein Families
Type I cytokine receptor family, Type 1 subfamily
Tissue Specificity
Highly expressed in both adult and fetal liver. Lower levels in kidney, anterior pituitary, skeletal muscle, adipose tissue and mammary gland.