Home
Product
Protein
Transmembrane Proteins
Recombinant Bovine Gonadotropin-releasing hormone receptor (GNRHR)

Recombinant Bovine Gonadotropin-releasing hormone receptor (GNRHR)

Code: CSB-CF009637BO

Rate （N/A）
Review （0）

Size:

20μg100μg

US$4949

Quantity:

Express system: in vitro E.coli expression system

Species: Bos taurus (Bovine)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

GNRHR

Uniprot NO.

P32236

Alternative Names

GNRHR; Gonadotropin-releasing hormone receptor; GnRH receptor; GnRH-R

Species

Bos taurus (Bovine)

Source

in vitro E.coli expression system

Expression Region

1-328

Target Protein Sequence

MANSDSPEQNENHCSAINSSIPLTPGSLPTLTLSGKIRVTVTFFLFLLSTIFNTSFLLKL QNWTQRKEKRKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYL KLFSMYAPAFMMVVISLDRSLAITKPLAVKSNSKLGQFMIGLAWLLSSIFAGPQLYIFGM IHLADDSGQTEGFSQCVTHCSFPQWWHQAFYNFFTFSCLFIIPLLIMVICNAKIIFTLTR VLHQDPHKLQLNQSKNNIPRARLRTLKMTVAFATSFTVCWTPYYVLGIWYWFDPDMVNRV SDPVNHFFFLFAFLNPCFDPLIYGYFSL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

Full length protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage Condition

Store at -20°C, for extended storage, conserve at -20°C or -80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Receptor for gonadotropin releasing hormone (GnRH) that mediates the action of GnRH to stimulate the secretion of the gonadotropic hormones luteinizing hormone (LH) and follicle-stimulating hormone (FSH). This receptor mediates its action by association with G-proteins that activate a phosphatidylinositol-calcium second messenger system.

Gene References into Functions

The GRIA1 polymorphism exists in beef cows but it does not influence antral follicle numbers. The association between GnRHR genotype and age at first calving is likely not causal as this polymorphism is not functional. PMID:23478821
There was a significant correlation between frequency profile and timing of puberty among the studied breeds, which seems to suggest that genetic variation within bovine GNRHR gene could explain at least part of the reported variability. PMID:21030057
These results indicate that GnRHR gene can be a potential marker for improving sperm quality traits, and imply that bulls with GA or CT genotype should be selected in breeding program. PMID:21104139
Seven sequence variants (SVs) have been identified in exon 1 and in the promoter region upstream of the bovine gonadotrophin releasing hormone (GnRH) receptor; g.-108T>C alteration was associated with beneficial effects on fertility PMID:19968639