Home
Product
Protein
Transmembrane Proteins
Recombinant Bovine Gap junction beta-2 protein (GJB2)

Recombinant Bovine Gap junction beta-2 protein (GJB2)

Code: CSB-CF009452BO

Rate （N/A）
Review （0）

Size:

20μg100μg

US$4185

Quantity:

Express system: in vitro E.coli expression system

Species: Bos taurus (Bovine)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

GJB2

Uniprot NO.

A2VE67

Alternative Names

GJB2; Gap junction beta-2 protein; Connexin-26; Cx26

Species

Bos taurus (Bovine)

Source

in vitro E.coli expression system

Expression Region

1-226

Target Protein Sequence

MDWGGLHTILGGVNKHSTSIGKIWLTVLFIFRIMILVVAAKEVWGDEQADFVCNTLQPGC KNVCYDHYFPISHIRLWALQLIFVSTPALLVAMHVAYYRHEKKRKFIRGEIKTEFKDIEE IKKQKVRIEGSLWWTYTGSIFFRVIFEAAFMYVFYVMYDGFAMQRLVKCNAWPCPNTVDC FVSRPTEKTVFTVFMIAVSGICILLNVTELCYLLIRFCSGKSKKPV
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

Full length protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage Condition

Store at -20°C, for extended storage, conserve at -20°C or -80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell.

Gene References into Functions

intermediate invasive status of bovine trophoblast is supported by the fact that trophoblast giant cells coexpress connexins (Cx)26, Cx32, and Cx43 PMID:16310041

Hide All

Subcellular Location

Cell membrane; Multi-pass membrane protein. Cell junction, gap junction.

Protein Families

Connexin family

Database Links

UNIGENE: Bt.64701

KEGG: bta:407154

STRING: 9913.ENSBTAP00000023167

Promotions