Recombinant Bovine Duffy antigen/chemokine receptor (DARC)

Code: CSB-CF884401BO
Size:
20μg
20μg100μg
US$4964
Quantity:
Express system: in vitro E.coli expression system
Species: Bos taurus (Bovine)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Target Names
ACKR1
Uniprot NO.
Species
Bos taurus (Bovine)
Source
in vitro E.coli expression system
Expression Region
1-330
Target Protein Sequence
MGNCLYPVADDNSTKLAIKEDFLIDFPEDYYPDYNETDVEAAAPCHSCSLLNYSSLPFFI LVSILGILASGTILYALLRPLFRWQLYQDRSTLVQLAVGSALFSIVVPILARGLSGALIT SLCHLAHLVAYGSAFAQALLIGYHACLGPQLGAGQVPGLRLGVTVGLWGVAALLSLPVVL GSDTSQGLCTVTFSGEWETLRYIHAAACFAIFVLLPLGLLGTKGLKTVLGRAPCPWVDVL WVWFIFWWPQGMTLGLDSLVRSKAIVVSTCPAQQALDMLLDVAEALAILHCVATPLLLAW VCYQATHTSPPSLPLPTTQTSHLDTLGGKS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Atypical chemokine receptor that controls chemokine levels and localization via high-affinity chemokine binding that is uncoupled from classic ligand-driven signal transduction cascades, resulting instead in chemokine sequestration, degradation, or transcytosis. Also known as interceptor (internalizing receptor) or chemokine-scavenging receptor or chemokine decoy receptor. Has a promiscuous chemokine-binding profile, interacting with inflammatory chemokines of both the CXC and the CC subfamilies but not with homeostatic chemokines. Acts as a receptor for chemokines including CCL2, CCL5, CCL7, CCL11, CCL13, CCL14, CCL17, CXCL5, CXCL6, IL8/CXCL8, CXCL11, GRO, RANTES, MCP-1 and TARC. May regulate chemokine bioavailability and, consequently, leukocyte recruitment through two distinct mechanisms: when expressed in endothelial cells, it sustains the abluminal to luminal transcytosis of tissue-derived chemokines and their subsequent presentation to circulating leukocytes; when expressed in erythrocytes, serves as blood reservoir of cognate chemokines but also as a chemokine sink, buffering potential surges in plasma chemokine levels.
Gene References into Functions
  1. the 5' flanking region of the DARC gene was isolated and characterized PMID:19559488

Show More

Hide All

Subcellular Location
Early endosome. Recycling endosome. Membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family, Atypical chemokine receptor subfamily
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products