Recombinant Bovine Cyclic nucleotide-gated cation channel alpha-3 (CNGA3)

Code: CSB-CF643680BO
Size:
20μg
20μg100μg
US$7777
Quantity:
Express system: in vitro E.coli expression system
Species: Bos taurus (Bovine)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Target Names
CNGA3
Uniprot NO.
Alternative Names
CNGA3; CNCG3; Cyclic nucleotide-gated cation channel alpha-3; Cone photoreceptor cGMP-gated channel subunit alpha; Cyclic nucleotide-gated channel alpha-3; CNG channel alpha-3; CNG-3; CNG3
Species
Bos taurus (Bovine)
Source
in vitro E.coli expression system
Expression Region
1-706
Target Protein Sequence
MAKISTQYSHPTRTHPSVRTMDRDLDCIENGLSRTHLPCEETSSELQEGIAMETRGLAES RQSSFTSQGPTRLSRLIISLRAWSARHLHQEDQRPDSFLERFRGAELQEVSSRESHVQFN VGSQEPPDRGRSAWPLARNNTNTCNNSEKDDKAKKEEKEKKEEKKENPKKEEKKKDSVVM DPSSNMYYHWLTVIAVPVFYNWCLLVCRACFDELQSEHLMLWLVLDYSADILYGMDMLVR ARTGFLEQGLMVMDASRLWKHYTQTLHFKLDVLSLVPTDLAYFKLGMNYPELRFNRLLKL ARLFEFFDRTETRTNYPNMFRIGNLVLYILIIIHWNACIYFAISKFIGFGTDSWVYPNVS NPEYGRLSRKYIYSLYWSTLTLTTIGETPPPVKDEEYLFVVIDFLVGVLIFATIVGNVGS MISNMNASRAEFQAKIDSIKQYMQFRKVTKDLETRVIRWFDYLWANKKTVDEKEVLKSLP DKLKAEIAINVHLDTLRKVRIFQDCEAGLLVELVLKLRPAVFSPGDYICKKGDIGREMYI IKEGKLAVVAEDGITQFVVLGDGSYFGEISILNIKGSKSGNRRTANIRSIGYSDLFCLSK DDLMEALTEYPEAKKALEEKGRQILMKDNLIDEELAKAGADPKDIEEKVEHLETSLDSLQ TRFARLLAEYNATQMKVKQRLSQLESQVKMGLPPDGDAPQTEASQP
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Visual signal transduction is mediated by a G-protein coupled cascade using cGMP as second messenger. This protein can be activated by cyclic GMP which leads to an opening of the cation channel and thereby causing a depolarization of cone photoreceptors. Essential for the generation of light-evoked electrical responses in the red-, green- and blue sensitive cones Induced a flickering channel gating, weakened the outward rectification in the presence of extracellular calcium, increased sensitivity for L-cis diltiazem and enhanced the cAMP efficacy of the channel when coexpressed with CNGB3. Could be responsible for cGMP-induced calcium entry in cells other than sensory cells. Might be involved in chemotaxis of sperm.
Gene References into Functions
  1. the S4 structural motif of CNGA3 is important for cellular processing of cone photoreceptor cyclic GMP-gated ion channels PMID:15024024

Show More

Hide All

Subcellular Location
Membrane; Multi-pass membrane protein.
Protein Families
Cyclic nucleotide-gated cation channel (TC 1.A.1.5) family, CNGA3 subfamily
Tissue Specificity
Testis, kidney, retinal cone and heart.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products