MAKISTQYSHPTRTHPSVRTMDRDLDCIENGLSRTHLPCEETSSELQEGIAMETRGLAES RQSSFTSQGPTRLSRLIISLRAWSARHLHQEDQRPDSFLERFRGAELQEVSSRESHVQFN VGSQEPPDRGRSAWPLARNNTNTCNNSEKDDKAKKEEKEKKEEKKENPKKEEKKKDSVVM DPSSNMYYHWLTVIAVPVFYNWCLLVCRACFDELQSEHLMLWLVLDYSADILYGMDMLVR ARTGFLEQGLMVMDASRLWKHYTQTLHFKLDVLSLVPTDLAYFKLGMNYPELRFNRLLKL ARLFEFFDRTETRTNYPNMFRIGNLVLYILIIIHWNACIYFAISKFIGFGTDSWVYPNVS NPEYGRLSRKYIYSLYWSTLTLTTIGETPPPVKDEEYLFVVIDFLVGVLIFATIVGNVGS MISNMNASRAEFQAKIDSIKQYMQFRKVTKDLETRVIRWFDYLWANKKTVDEKEVLKSLP DKLKAEIAINVHLDTLRKVRIFQDCEAGLLVELVLKLRPAVFSPGDYICKKGDIGREMYI IKEGKLAVVAEDGITQFVVLGDGSYFGEISILNIKGSKSGNRRTANIRSIGYSDLFCLSK DDLMEALTEYPEAKKALEEKGRQILMKDNLIDEELAKAGADPKDIEEKVEHLETSLDSLQ TRFARLLAEYNATQMKVKQRLSQLESQVKMGLPPDGDAPQTEASQP
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Visual signal transduction is mediated by a G-protein coupled cascade using cGMP as second messenger. This protein can be activated by cyclic GMP which leads to an opening of the cation channel and thereby causing a depolarization of cone photoreceptors. Essential for the generation of light-evoked electrical responses in the red-, green- and blue sensitive cones Induced a flickering channel gating, weakened the outward rectification in the presence of extracellular calcium, increased sensitivity for L-cis diltiazem and enhanced the cAMP efficacy of the channel when coexpressed with CNGB3. Could be responsible for cGMP-induced calcium entry in cells other than sensory cells. Might be involved in chemotaxis of sperm.
Gene References into Functions
the S4 structural motif of CNGA3 is important for cellular processing of cone photoreceptor cyclic GMP-gated ion channelsPMID:15024024