Home
Product
Protein
Transmembrane Proteins
Recombinant Bovine C-X-C chemokine receptor type 4 (CXCR4)

Recombinant Bovine C-X-C chemokine receptor type 4 (CXCR4)

Code: CSB-CF006254BO

Rate （N/A）
Review （0）

Size:

20μg100μg

US$5136

Quantity:

Express system: in vitro E.coli expression system

Species: Bos taurus (Bovine)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

CXCR4

Uniprot NO.

P25930

Species

Bos taurus (Bovine)

Source

in vitro E.coli expression system

Expression Region

1-353

Target Protein Sequence

MEGIRIFTSDNYTEDDLGSGDYDSMKEPCFREENAHFNRIFLPTVYSIIFLTGIVGNGLV ILVMGYQKKLRSMTDKYRLHLSVADLLFVLTLPFWAVDAVANWYFGKFLCKAVHVIYTVN LYSSVLILAFISLDRYLAIVHATNSQKPRKLLAEKVVYVGVWLPAVLLTIPDLIFADIKE VDERYICDRFYPSDLWLVVFQFQHIVVGLLLPGIVILSCYCIIISKLSHSKGYQKRKALK TTVILILTFFACWLPYYIGISIDSFILLEIIQQGCEFESTVHKWISITEALAFFHCCLNP ILYAFLGAKFKTSAQHALTSVSRGSSLKILSKGKRGGHSSVSTESESSSFHSS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

Full length protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Receptor for the C-X-C chemokine CXCL12/SDF-1 that transduces a signal by increasing intracellular calcium ion levels and enhancing MAPK1/MAPK3 activation. Involved in the AKT signaling cascade. Plays a role in regulation of cell migration, e.g. during wound healing. Acts as a receptor for extracellular ubiquitin; leading to enhanced intracellular calcium ions and reduced cellular cAMP levels. Binds bacterial lipopolysaccharide (LPS) et mediates LPS-induced inflammatory response, including TNF secretion by monocytes. Involved in hematopoiesis and in cardiac ventricular septum formation. Also plays an essential role in vascularization of the gastrointestinal tract, probably by regulating vascular branching and/or remodeling processes in endothelial cells. Involved in cerebellar development. In the CNS, could mediate hippocampal-neuron survival.

Gene References into Functions

The current analysis failed in identifying a causal mutation on the CXCR4 gene underlying a previously reported quantitative trait loci for cattle trypanotolerance on bovine chromosome 2. PMID:27117936
There is a potential link between follicular SDF1/CXCR4 activation and the regulation of ovulation-related genes in cows and horses. PMID:24784705
The combination of low expression of CXCR4 and high expression of IL-10 might be closely concerned with some bias for the production of PI calves. PMID:24059096

Hide All

Subcellular Location

Cell membrane; Multi-pass membrane protein. Cell junction. Early endosome. Late endosome. Lysosome.

Protein Families

G-protein coupled receptor 1 family

Tissue Specificity

Brain, heart, kidney, lung and liver.

Database Links

UNIGENE: Bt.8957

KEGG: bta:281736

STRING: 9913.ENSBTAP00000001406

Promotions