Recombinant Bovine C-X-C chemokine receptor type 2 (CXCR2)

Code: CSB-CF632950BO
Size:
20μg
20μg100μg
US$5188
Quantity:
Express system: in vitro E.coli expression system
Species: Bos taurus (Bovine)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Target Names
CXCR2
Uniprot NO.
Species
Bos taurus (Bovine)
Source
in vitro E.coli expression system
Expression Region
1-360
Target Protein Sequence
MTIILKDLSNSSILWEGFEDEFGNYSGTPPTEDYDYSPCEISTETLNKYAVVVIDALVFL LSLLGNSLVMLVILYSRIGRSVTDVYLLNLAMADLLFAMTLPIWTASKAKGWVFGTPLCK VVSLLKEVNFYSGILLLACISMDRYLAIVHATRTLTQKWHWVKFICLGIWALSVILALPI FIFREAYQPPYSDLVCYEDLGANTTKWRMIMRVLPQTFGFLLPLLVMLFCYGFTLRTLFS AQMGHKHRAMRVIFAVVLVFLLCWLPYNLVLIADTLMRAHVIAETCQRRNDIGRALDATE ILGFLHSCLNPLIYVFIGQKFRHGLLKIMAIHGLISKEFLAKDGRPSFVGSSSGNTSTTL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Receptor for interleukin-8 which is a powerful neutrophil chemotactic factor. Binding of IL-8 to the receptor causes activation of neutrophils. This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system. Binds to IL-8 with high affinity. Also binds with high affinity to CXCL3, GRO/MGSA and NAP-2.
Gene References into Functions
  1. no statistically significant association of the SNP CXCR1+777 or CXCR1-1768 with SCS was found PMID:19620685
  2. Data describe the expression of IL-8, IL-1beta and their respective receptors, CXCR1 and IL-1R1 in bovine theca cells, and suggest that VEGF is associated with the IL system in theca cells in ovary. PMID:20156197
  3. The aim of this study was to demonstrate the presence of the two SNPs in the CXCR1 gene of Japanese Black cattle and examine the association between the SNPs and clinical diseases including intestinal and respiratory diseases in calves. PMID:20697186
  4. Association between interleukin-8 receptor-alpha (CXCR1) polymorphism and disease incidence, production, reproduction, and survival in Holstein cows. PMID:21426999
  5. The situation of CXCR1 polymorphisms in Chinese Holstein cattle and determine the relationship between the CXCR1 SNPs and mastitis resistance. PMID:21774621
  6. highly polymorphic PMID:22056270
  7. The results suggests the possible role of CXCR1 gene SNPs in the host response against mastitis. PMID:23979897
  8. CXCR1 polymorphisms influence viability and concentration of milk polymorphonuclear neutrophilic leukocytes. PMID:24934516
  9. The results demonstrate that CXCR1 polymorphism can influence somatic cell count and milk neutrophil viability following experimental mastitis. PMID:25933826
  10. In the present study no association could be detected between superoxide production by isolated bovine neutrophils during early lactation and CXCR1 gene polymorphism. IL-8 showed to possess inhibitory effects on ROS generation in bovine neutrophils. PMID:25944115
  11. Polymorphisms in CXCR1 are significantly associated with bovine mastitis PMID:26126595
  12. (PCR) was used to detect the methylation status of CXCR1 CpG island, and quantitative fluorescence PCR was used to detect CXCR1 expression in bovine mammary tissue PMID:26505411

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products