Home
Product
Protein
Transmembrane Proteins
Recombinant Bovine C-C chemokine receptor type 11 (CCRL1)

Recombinant Bovine C-C chemokine receptor type 11 (CCRL1)

Code: CSB-CF004850BO

Rate （N/A）
Review （0）

Size:

20μg100μg

US$5113

Quantity:

Express system: in vitro E.coli expression system

Species: Bos taurus (Bovine)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

ACKR4

Uniprot NO.

P35350

Alternative Names

ACKR4; CCR11; CCRL1; Atypical chemokine receptor 4; C-C chemokine receptor type 11; C-C CKR-11; CC-CKR-11; CCR-11; CC chemokine receptor-like 1; Protein PPR1; Putative gustatory receptor type B

Species

Bos taurus (Bovine)

Source

in vitro E.coli expression system

Expression Region

1-350

Target Protein Sequence

MAVEYNQSTDYYYEENEMNDTHDYSQYEVICIKEEVRKFAKVFLPAFFTIAFIIGLAGNS TVVAIYAYYKKRRTKTDVYILNLAVADLFLLFTLPFWAVNAVHGWVLGKIMCKVTSALYT VNFVSGMQFLACISTDRYWAVTKAPSQSGVGKPCWVICFCVWVAAILLSIPQLVFYTVNH KARCVPIFPYHLGTSMKASIQILEICIGFIIPFLIMAVCYFITAKTLIKMPNIKKSQPLK VLFTVVIVFIVTQLPYNIVKFCQAIDIIYSLITDCDMSKRMDVAIQITESIALFHSCLNP VLYVFMGTSFKNYIMKVAKKYGSWRRQRQNVEEIPFESEDATEPTSTFSI
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

Full length protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage Condition

Store at -20°C, for extended storage, conserve at -20°C or -80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Atypical chemokine receptor that controls chemokine levels and localization via high-affinity chemokine binding that is uncoupled from classic ligand-driven signal transduction cascades, resulting instead in chemokine sequestration, degradation, or transcytosis. Also known as interceptor (internalizing receptor) or chemokine-scavenging receptor or chemokine decoy receptor. Acts as a receptor for chemokines CCL2, CCL8, CCL13, CCL19, CCL21 and CCL25. Chemokine-binding does not activate G-protein-mediated signal transduction but instead induces beta-arrestin recruitment, leading to ligand internalization. Plays an important role in controlling the migration of immune and cancer cells that express chemokine receptors CCR7 and CCR9, by reducing the availability of CCL19, CCL21, and CCL25 through internalization. Negatively regulates CXCR3-induced chemotaxis. Regulates T-cell development in the thymus.

Subcellular Location

Early endosome. Recycling endosome. Cell membrane; Multi-pass membrane protein.

Protein Families

G-protein coupled receptor 1 family, Atypical chemokine receptor subfamily

Tissue Specificity

Expressed in circumvallate and fungiform papillae, olfactory epithelium and lung. Lower expression in liver, kidney and tongue epithelium bearing no taste papillae. Very low expression in the cerebral cortex of the brain.

Database Links

UNIGENE: Bt.565

KEGG: bta:281672

STRING: 9913.ENSBTAP00000026082

Promotions