Recombinant Bovine C-C chemokine receptor type 11 (CCRL1)

Code: CSB-CF004850BO
Size:
20μg
20μg100μg
US$5113
Quantity:
Express system: in vitro E.coli expression system
Species: Bos taurus (Bovine)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Target Names
ACKR4
Uniprot NO.
Alternative Names
ACKR4; CCR11; CCRL1; Atypical chemokine receptor 4; C-C chemokine receptor type 11; C-C CKR-11; CC-CKR-11; CCR-11; CC chemokine receptor-like 1; Protein PPR1; Putative gustatory receptor type B
Species
Bos taurus (Bovine)
Source
in vitro E.coli expression system
Expression Region
1-350
Target Protein Sequence
MAVEYNQSTDYYYEENEMNDTHDYSQYEVICIKEEVRKFAKVFLPAFFTIAFIIGLAGNS TVVAIYAYYKKRRTKTDVYILNLAVADLFLLFTLPFWAVNAVHGWVLGKIMCKVTSALYT VNFVSGMQFLACISTDRYWAVTKAPSQSGVGKPCWVICFCVWVAAILLSIPQLVFYTVNH KARCVPIFPYHLGTSMKASIQILEICIGFIIPFLIMAVCYFITAKTLIKMPNIKKSQPLK VLFTVVIVFIVTQLPYNIVKFCQAIDIIYSLITDCDMSKRMDVAIQITESIALFHSCLNP VLYVFMGTSFKNYIMKVAKKYGSWRRQRQNVEEIPFESEDATEPTSTFSI
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Atypical chemokine receptor that controls chemokine levels and localization via high-affinity chemokine binding that is uncoupled from classic ligand-driven signal transduction cascades, resulting instead in chemokine sequestration, degradation, or transcytosis. Also known as interceptor (internalizing receptor) or chemokine-scavenging receptor or chemokine decoy receptor. Acts as a receptor for chemokines CCL2, CCL8, CCL13, CCL19, CCL21 and CCL25. Chemokine-binding does not activate G-protein-mediated signal transduction but instead induces beta-arrestin recruitment, leading to ligand internalization. Plays an important role in controlling the migration of immune and cancer cells that express chemokine receptors CCR7 and CCR9, by reducing the availability of CCL19, CCL21, and CCL25 through internalization. Negatively regulates CXCR3-induced chemotaxis. Regulates T-cell development in the thymus.
Subcellular Location
Early endosome. Recycling endosome. Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family, Atypical chemokine receptor subfamily
Tissue Specificity
Expressed in circumvallate and fungiform papillae, olfactory epithelium and lung. Lower expression in liver, kidney and tongue epithelium bearing no taste papillae. Very low expression in the cerebral cortex of the brain.
Database Links

UNIGENE: Bt.565

KEGG: bta:281672

STRING: 9913.ENSBTAP00000026082

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products