Home
Product
Protein
Transmembrane Proteins
Recombinant Bovine BCL2/adenovirus E1B 19 kDa protein-interacting protein 3 (BNIP3)

Recombinant Bovine BCL2/adenovirus E1B 19 kDa protein-interacting protein 3 (BNIP3)

Code: CSB-CF656958BO

Rate （N/A）
Review （0）

Size:

20μg100μg

US$3961

Quantity:

Express system: in vitro E.coli expression system

Species: Bos taurus (Bovine)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

BNIP3

Uniprot NO.

Q32KN2

Alternative Names

BNIP3; BCL2/adenovirus E1B 19 kDa protein-interacting protein 3

Species

Bos taurus (Bovine)

Source

in vitro E.coli expression system

Expression Region

1-196

Target Protein Sequence

MSQSESPGLQEESLHGSWVELHFGSNGNGSSVPDSVSIYKGDMEKILLDAQHESGRSSSK SSHCDSPPRSQTPQDTNRASETDTHSLGEKNSSQSEEDYMERRKEVESILKKNSDWIWDW SSRPENVPPAKEFLLFKHPKRTPTLSMRNTSVMKKGGIFSAEFLKVFLPSLLLSHLLAIG LGIYIGRRLTTSTSTF
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

full length protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage Condition

Store at -20°C, for extended storage, conserve at -20°C or -80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Apoptosis-inducing protein that can overcome BCL2 suppression. May play a role in repartitioning calcium between the two major intracellular calcium stores in association with BCL2. Involved in mitochondrial quality control via its interaction with SPATA18/MIEAP: in response to mitochondrial damage, participates in mitochondrial protein catabolic process (also named MALM) leading to the degradation of damaged proteins inside mitochondria. The physical interaction of SPATA18/MIEAP, BNIP3 and BNIP3L/NIX at the mitochondrial outer membrane may play a critical role in the translocation of lysosomal proteins from the cytoplasm to the mitochondrial matrix. The physical interaction of SPATA18/MIEAP, BNIP3 and BNIP3L/NIX at the mitochondrial outer membrane regulates the opening of a pore in the mitochondrial double membrane in order to mediate the translocation of lysosomal proteins from the cytoplasm to the mitochondrial matrix. Plays an important role in the calprotectin (S100A8/A9)-induced cell death pathway.

Subcellular Location

Mitochondrion. Mitochondrion outer membrane; Single-pass membrane protein.

Protein Families

NIP3 family

Database Links

UNIGENE: Bt.1411

KEGG: bta:615342

STRING: 9913.ENSBTAP00000023684

Promotions