Home
Product
Protein
Transmembrane Proteins
Recombinant Bovine B-cell antigen receptor complex-associated protein alpha chain (CD79A)

Recombinant Bovine B-cell antigen receptor complex-associated protein alpha chain (CD79A)

Code: CSB-CF004957BO

Rate （N/A）
Review （0）

Size:

20μg100μg

US$3931

Quantity:

Express system: in vitro E.coli expression system

Species: Bos taurus (Bovine)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

CD79A

Uniprot NO.

P40293

Alternative Names

CD79A; IGA; MB-1; B-cell antigen receptor complex-associated protein alpha chain; Ig-alpha; MB-1 membrane glycoprotein; Membrane-bound immunoglobulin-associated protein; Surface IgM-associated protein; CD antigen CD79a

Species

Bos taurus (Bovine)

Source

in vitro E.coli expression system

Expression Region

32-223

Target Protein Sequence

LWVEWGPPSVTVSVGEEVRLQCTHNGSNTNVTWWHVLQSNSSWPPVMYRGDVGAGGELIIKPVNKTHRGMYRCQVSDGKKIQRSCGTYLRVRDPLPRPFLDMGEGTKNNIITAEGIILLICAVVPGTLLLFRKRWQNMKFGADIQDDYEDENLYEGLNLDDCSMYEDISRGLQGTYQDVGSLHIGDAQLEKP
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage Condition

Store at -20°C, for extended storage, conserve at -20°C or -80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Required in cooperation with CD79B for initiation of the signal transduction cascade activated by binding of antigen to the B-cell antigen receptor complex (BCR) which leads to internalization of the complex, trafficking to late endosomes and antigen presentation. Also required for BCR surface expression and for efficient differentiation of pro- and pre-B-cells. Stimulates SYK autophosphorylation and activation. Binds to BLNK, bringing BLNK into proximity with SYK and allowing SYK to phosphorylate BLNK. Also interacts with and increases activity of some Src-family tyrosine kinases. Represses BCR signaling during development of immature B-cells.

Subcellular Location

Cell membrane; Single-pass type I membrane protein.

Tissue Specificity

B-cells.

Database Links

UNIGENE: Bt.4436

KEGG: bta:281674

STRING: 9913.ENSBTAP00000002451

Promotions