PAHLLQEEISSSYTTTTTITAPPSRVLQNGGGKLEKTPLYLEEDIRPEMRDDIYDPTYQD KEGPKPKLEYVWRNIILMSLLHLGALYGITLIPTCKIYTYIWVLFYYLMGALGITAGAHR LWSHRTYKARLPLRVFLIIGNTMAFQNDVFEWSRDHRAHHKFSETDADPHNSRRGFFFSH VGWLLVRKHPAVKEKGSTLNLSDLRAEKLVMFQRRYYKPGVLLLCFILPTLVPWYLWDET FQNSLFFATLFRYALGLNVTWLVNSAAHMYGYRPYDKTINPRENILVSLGAAGEGFHNYH HTFPYDYSASEYRWHINFTTFFIDCMAAIGLAYDRKKVSKAAILARIKRTGEESYKSG
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Stearoyl-CoA desaturase that utilizes O(2) and electrons from reduced cytochrome b5 to introduce the first double bond into saturated fatty acyl-CoA substrates. Catalyzes the insertion of a cis double bond at the delta-9 position into fatty acyl-CoA substrates including palmitoyl-CoA and stearoyl-CoA. Gives rise to a mixture of 16:1 and 18:1 unsaturated fatty acids. Plays an important role in lipid biosynthesis. Plays an important role in regulating the expression of genes that are involved in lipogenesis and in regulating mitochondrial fatty acid oxidation. Plays an important role in body energy homeostasis. Contributes to the biosynthesis of membrane phospholipids, cholesterol esters and triglycerides.
Gene References into Functions
Expression of SCD1 was downregulated through reduced transcription and abundance of the transcription factor sterol regulatory element-binding protein 1 (SREBP1c).This effect was augmented by local chromatin tightening and DNA methylation at and around the SREBP1c binding site in the SCD1 promoterPMID:29274956
It plays important roles in growth and lipid metabolisms.PMID:29154485
E. coli mastitis reduced SCD1 expression in liver and udder.PMID:27439381
Here, the association between DGAT1 K232A, SCD1 A293V, and LEPR T945M markers with milk fat composition in southern Chile was evaluated. The most frequent variants for DGAT1, SCD1, and LEPR polymorphisms were GC/GC, C, and C, respectively. The SCD1 CC genotype was associated with a low cholesterolemic FA content, a high ratio of linolenic acid to cholesterolemic FA, and lower conjugated-linolenic acid and PUFA content.PMID:27173340
significant effects of the SCD gene on milk medium- and long-chain unsaturated fatty acids, especially for C14:1 and C14 index in dairy cattlePMID:26970560
Studied the responsiveness of bovine SCD1 promoter to serum, insulin, oleic acid, and NFY transcription factor in BME-UV1 cells.PMID:26158455
The results suggest that a mutation of SCD1, but not LEPR or ABCG2, might be useful as a DNA marker to decrease reproductive problems and improve production traits in Iranian Holstein dairy cows.PMID:25130486
Suppression of CPT1B and induction of SCD and CEBPB by supplemental arginine promotes increased adiposity in Angus steers.PMID:24327170
This study showed that milk somatic cells can be used as a source of mRNA to study SCD1 expression in dairy cows, offering a non-invasive alternative to mammary tissue samples obtained by biopsy.PMID:22369625
This study presents evidence that there are breed- and diet-induced variations on lipid metabolism in the muscle, which may be, at least partially, modulated by the stearoyl-CoA desaturase (SCD) gene expression levels.PMID:23467818
effects of A293V polymorphism on milk fat composition in winter and summerPMID:23127906
These results provide detailed genetic information for the SREBP1 signalling pathway and SCD that can be used to change milk fat composition by marker-assisted breeding.PMID:22114848
study evaluated the contributions of polymorphisms of FASN and SCD genes on fatty acid composition in muscle in two different populations: 1189 and 1058 Japanese Black cattle from the Miyagi and the Yamagata populationsPMID:22497525
Stearoyl-coenzyme A desaturase SNPs effect milk yield in the Chinese dairy population.PMID:22722989
Results suggest that SCD and FASN are strong candidate genes influencing fatty acid composition in beef cattle.PMID:22221030
The expression of the stearoyl-CoA desaturase gene was higher in the adipose tissue of heifers compared to bulls and gene expression is partly associated with adipose tissue fatty acid composition.PMID:21640489
It was concluded that, unlike essential fatty acids, the fatty acid composition of adipose tissue is regulated by adipose tissue fatty acid desaturation, with little contribution from hepatic or duodenal fatty acids.PMID:21454869
The effects of genetic polymorphisms of liver X receptor, alpha (LXR), stearoyl-CoA desaturase (SCD), Fatty acid synthase (FASN), and Fatty acid binding protein 4 (FABP4) were investigated on fatty acid composition in fat tissue of steers.PMID:21615833
This study confirms the fundamental role of SCD1 genes in transforming saturated fatty acids into monounsaturated fatty acids.PMID:21145173
Results describe the diet-induced effects of sustained upregulation of stearoyl-CoA desaturase on milk fat synthesis and lipogenic gene networks.PMID:20607344
The results of this study demonstrated the existence of the polymorphisms in the SCD1 and SREBP-1 genes in the population of Fleckvieh cattle and their associations with the concentrations of several muscle fat and subscutaneous fat fatty acids.PMID:20374858
SCD1 showed significant association with C14:1 cis-9 and C14:1 cis-9/C14:0, which is considered the best proxy of the desaturation activity in mammary glandPMID:20105547
no significant effect of the SCD1 variants on any of the reproductive traitsPMID:19841232
SNPs in the 3'UTR of the SCD1 gene could therefore explain some of the within-breed variations in mono-unsaturated fatty acids content of milk fat.PMID:19765166
Sequences of scd promoter of cows producing high milk CLA compared with low CLA showed no polymorphisms in this promoter segment or among scd promoter of Holstein Friesian, Montbeliarde, Normande, Norwegian Red, Charlois, Limousin & Kerry breeds.PMID:15834635
A transcriptional enhancer element in the stearoyl-CoA desaturase promoter was identified and characterized.PMID:16603123
In this paper, we describe for the first time a second SCD isoform in cattle, which appears to be an ortholog of human SCD5 rather than a homolog of bovine SCD1 or any of the described murine SCD isoformsPMID:17468887
study concludes that the higher desaturase activity of SCD allele C in the composition of milk fat can only be appreciated on myristic and caproleic FA because of the different pathways from which milk FA derivePMID:17582140
Single nucleotide polymorphisms in the open reading frame of the SCD gene and resulting genetic variants in Canadian Holstein and Jersey cows are reported.PMID:17654011
results provide some indication of an association between Stearoyl-CoA desaturase (SCD) locus and the fatty acid profile in the milk of Italian HolsteinsPMID:17699067
SCD mRNA levels were significantly increased 10.8 and 6.3-fold in cultured adipocytes from Japanese Black and Holstein, respectively. The difference in SCD expression may reflect differences in the fat development characteristics of the breeds.PMID:17851104
direct influence of SCD polymorphism on fatty acid composition of milk and beefPMID:18254828
selective breeding can contribute to higher unsaturation indices, and that selective breeding can capitalize on genotypic information of both stearoyl-CoA desaturase (SCD1)and diacylglycerol O-acyltransferase homolog 1(DGAT1)polymorphismPMID:18420645
a possible use of the SCD locus in gene-assisted selection programs for the improvement of milk production traits in dairy cattlePMID:18650296
The endogenous production of monounsaturated fatty acids is linked to the Delta(9)-desaturase activityPMID:18650299
Data show that SCD1 gene as a critical player in skeletal muscle fat metabolism.PMID:18825276