ABCG2; Broad substrate specificity ATP-binding cassette transporter ABCG2; ATP-binding cassette sub-family G member 2; Urate exporter; CD antigen CD338
Species
Bos taurus (Bovine)
Source
in vitro E.coli expression system
Expression Region
1-655
Target Protein Sequence
MSSNSYEVSIPMSKKLNGIPETTSKDLQTLTEGAVLSFHNICYRVKVKTGFLLCRKTIEK EILANINGVMKPGLNAILGPTGGGKSSLLDILAARKDPHGLSGDVLINGAPRPANFKCNS GYVVQDDVVMGTLTVRENLQFSAALRLPTTMTSYEKNERINKVIQELGLDKVADSKVGTQ FIRGVSGGERKRTSIAMELITDPSILFLDEPTTGLDSSTANAVLLLLKRMSKQGRTIIFS IHQPRYSIFKLFDSLTLLASGRLMFHGPAQEALGYFGAIGFRCEPYNNPADFFLDIINGD SSAVVLNREDIGDEANETEEPSKKDTPLIEKLAEFYVNSSFFKETKVELDKFSGDQRRKK LPSYKEVTYATSFCHQLKWISRRSFKNLLGNPQASIAQLIVTVFLGLVIGAIFYDLKNDP AGIQNRAGVLFFLTTNQCFSSVSAVELLVVEKKLFIHEYISGYYRVSSYFFGKLLSDLLP MRMLPSIIFTCITYFLLGLKPKVEAFFIMMLTLMMVAYSASSMALAIAAGQSVVSIATLL MTISFVFMMIFSGLLVNLKTVVPWLSWLQYLSIPRYGYAALQHNEFLGQNFCPGLNVTTN NTCSYAICTGEEFLTNQGIDISPWGLWKNHVALACMIVIFLTIAYLKLLFLKKFS
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Broad substrate specificity ATP-dependent transporter of the ATP-binding cassette (ABC) family that actively extrudes a wide variety of physiological compounds, dietary toxins and xenobiotics from cells. Involved in porphyrin homeostasis, mediating the export of protoporphyrin IX (PPIX) from both mitochondria to cytosol and cytosol to extracellular space, it also functions in the cellular export of heme. Also mediates the efflux of sphingosine-1-P from cells. Acts as a urate exporter functioning in both renal and extrarenal urate excretion. In kidney, it also functions as a physiological exporter of the uremic toxin indoxyl sulfate. Also involved in the excretion of steroids like estrone 3-sulfate/E1S, 3beta-sulfooxy-androst-5-en-17-one/DHEAS, and other sulfate conjugates. Mediates the secretion of the riboflavin and biotin vitamins into milk. Extrudes pheophorbide a, a phototoxic porphyrin catabolite of chlorophyll, reducing its bioavailability. Plays an important role in the exclusion of xenobiotics from the brain. It confers to cells a resistance to multiple drugs and other xenobiotics including mitoxantrone, pheophorbide, camptothecin, methotrexate, azidothymidine, and the anthracyclines daunorubicin and doxorubicin, through the control of their efflux. In placenta, it limits the penetration of drugs from the maternal plasma into the fetus. May play a role in early stem cell self-renewal by blocking differentiation.
Gene References into Functions
ABCG2 single nucleotide polymorphisms associated with milk fatty acids in a Chinese Holstein cattle.PMID:27468856
These findings point to a significant role of the ABCG2 Y581S polymorphism in the milk disposition of enterolactone and the endogenous molecules riboflavin and uric acid, which could affect both milk quality and functionality.PMID:26510964
The results suggest that a mutation of SCD1, but not LEPR or ABCG2, might be useful as a DNA marker to decrease reproductive problems and improve production traits in Iranian Holstein dairy cows.PMID:25130486
P-gp, Bcrp and Mrp1 are functionally expressed in bovine/rat co-culture model and model is suitable for investigations of small molecule transport.PMID:24934296
This study has, for the first time, confirmed the expression of ABCG2 in epithelial cells of the bovine rumen.PMID:24747985
These results contribute to the role of ABCG2 in cytoprotection and disposition in important tissue barriers and may have important implications for veterinary pharmacotherapy of dairy animals.PMID:23473424
Generated cell culture model allows rapid and high-throughput screening of potential ruminant ABCG2 substrate, increasing the understanding of carrier-associated secretion of xenobiotics into milk.PMID:23192864
Bovine ABCG2 Tyr581Ser single-nucleotide polymorphism increases milk secretion of the veterinary antibiotic danofloxacin.PMID:23230133
ABCG2 plays a role in mammary epithelial cell proliferation, and functional polymorphisms in this gene may influence the cellular compartment of the mammary gland and potentially milk production.PMID:22870877
plays a role in epididymal sperm maturation, but not after ejaculationPMID:22441796
The effect of the Y581S polymorphism of ABCG2 on transcellular transport of veterinary drugs was studied because this could alter substrate pharmacokinetics and milk residues.PMID:21821808
Data suggest that the BB genotype of bovine ABCG2 is a molecular marker for superior milk performance.PMID:20140710
The recent progress in mapping quantitative trait nucleotides (QTNs) are reviewed, including the ABCG2 gene mutation that underlies a QTL for fat and protein content and the ovine MSTN gene mutation that causes muscular hypertrophy in Texel sheep.PMID:20720303
associated with increased fat yield, fat and protein percent as well as decrease in milk yield; also in Bos indicus and Bubalus bubalisPMID:17087837
The allele frequencies of ABCG2(A) and ABCG2(C) were determined in 32 Bos taurus and 3 Bos indicus breeds. The detection of ABCG2(C) only in Bos taurus breeds may indicate that ABCG2(A) is the ancestral allele.PMID:17106124
The C allele of ABCG2_49 is found in a marker haplotype that has an extremely negative effect on fat and protein percentages and positive effect on milk yieldPMID:17584938