Home
Product
Protein
Transmembrane Proteins
Recombinant Bison bison Toll-like receptor 2 (TLR2)

Recombinant Bison bison Toll-like receptor 2 (TLR2)

Code: CSB-CF023601BTE

Rate （N/A）
Review （0）

Size:

20μg100μg

US$8211

Quantity:

Express system: in vitro E.coli expression system

Species: Bison bison (American bison) (Bos bison)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

TLR2

Uniprot NO.

B2LT61

Species

Bison bison (American bison) (Bos bison)

Source

in vitro E.coli expression system

Expression Region

21-784

Target Protein Sequence

ASDQASSLSCDSTGVCDGHSRSLNSIPSGLTAGVKSLDLSNNEITYVGNRDLQRCVNLKTLRLGANEIHTVEEDSFFHLRNLEYLDLSYNRLSNLSSSWFRSLYVLKFLNLLGNLYKTLGETSLFSHLPNLXTLKVGNSNSFTEIHEKDFTGLTFLEELEISAQNLQIYVPKSLKSIQNISHLILHLKQPVLLVDILVDIVSSLDCLELRDTNLHTFHFSEASISEMSTSVKKLIFRNVQFTDESFVEVVKLFNYVSGILEVEFDDCTHDGIGDFRALSLDRIRHLGNVETLTIRKLHIPQFFLFHDLSSIYPLTGKVKRVTIENSKVFLVPCLLSQHLKSLEYLDLSENLMSEETLKNSACKDAWPFLQTLVLRQNRLKSLEKTGELLLTLENLNSLDISKNNFLSMPETCQWPGKMKQLNLSSTRIHSLTQCLPQTLEILDVSNNNLDSFSLILPQLKELYISRNKLKTLPDASFLPVLSVMRISRNIINTFSKEQLDSFQQLKTLEAGGNNFICSCDFLSFTQGQQALGRVLVDWPDDYRCDSPSHVRGQRVQDARLSLSECHRAAVVSAACCALFLVLLLTGVLCHRFHGLWYMKMMWAWLQAKRKPRKAPRRDICYDAFVSYSERDSYWVENLMVQELEQFNPPFKLCLHKRDFIPGKWIIDNIIDSIEKSHKTIFVLSENFVXSEWCKYELDFSHFRLFDENNDAAILILLEPIDKKAIPQRFCKLRKIMNTKTYLEWPVDETQQEGFWLNLRAAIRS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

full length protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Cooperates with LY96 to mediate the innate immune response to bacterial lipoproteins and other microbial cell wall components. Cooperates with TLR1 or TLR6 to mediate the innate immune response to bacterial lipoproteins or lipopeptides. Acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response. May also promote apoptosis in response to lipoproteins. Forms activation clusters composed of several receptors depending on the ligand, these clusters trigger signaling from the cell surface and subsequently are targeted to the Golgi in a lipid-raft dependent pathway. Forms the cluster TLR2:TLR6:CD14:CD36 in response to diacylated lipopeptides and TLR2:TLR1:CD14 in response to triacylated lipopeptides.

Subcellular Location

Membrane; Single-pass type I membrane protein. Cytoplasmic vesicle, phagosome membrane; Single-pass type I membrane protein. Membrane raft.

Protein Families

Toll-like receptor family

Promotions