Recombinant Arabidopsis thaliana Casparian strip membrane protein 5 (CASP5)

Code: CSB-CF878625DOA
Size:
20μg
20μg100μg
US$3894
Quantity:
Express system: in vitro E.coli expression system
Species: Arabidopsis thaliana (Mouse-ear cress)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Target Names
CASP5
Uniprot NO.
Species
Arabidopsis thaliana (Mouse-ear cress)
Source
in vitro E.coli expression system
Expression Region
1-187
Target Protein Sequence
MKSGQAEIMETSKGIQKSGLMSRRIAILEFILRIVAFFNTIGSAILMGTTHETLPFFTQF IRFQAEYNDLPALTFFVVANAVVSGYLILSLTLAFVHIVKRKTQNTRILLIILDVAMLGL LTSGASSAAAIVYLAHNGNNKTNWFAICQQFNSFCERISGSLIGSFIAIVLLILLILLSA IALSRRH
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Regulates membrane-cell wall junctions and localized cell wall deposition. Required for establishment of the Casparian strip membrane domain (CSD) and the subsequent formation of Casparian strips, a cell wall modification of the root endodermis that determines an apoplastic barrier between the intraorganismal apoplasm and the extraorganismal apoplasm and prevents lateral diffusion.
Subcellular Location
Cell membrane; Multi-pass membrane protein. Note=Very restricted localization following a belt shape within the plasma membrane which coincides with the position of the Casparian strip membrane domain.
Protein Families
Casparian strip membrane proteins (CASP) family
Database Links

UNIGENE: At.31822

KEGG: ath:AT5G15290

STRING: 3702.AT5G15290.1

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products