Home
Product
Protein
Transmembrane Proteins
Recombinant Arabidopsis thaliana Casparian strip membrane protein 1 (CASP1)

Recombinant Arabidopsis thaliana Casparian strip membrane protein 1 (CASP1)

Code: CSB-CF874426DOA

Rate （N/A）
Review （0）

Size:

20μg100μg

US$4036

Quantity:

Express system: in vitro E.coli expression system

Species: Arabidopsis thaliana (Mouse-ear cress)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

CASP1

Uniprot NO.

Q9SIH4

Alternative Names

CASP1; At2g36100; F9C22.3; Casparian strip membrane protein 1; AtCASP1

Species

Arabidopsis thaliana (Mouse-ear cress)

Source

in vitro E.coli expression system

Expression Region

1-206

Target Protein Sequence

MAKESTTIDVGEPSTVTKSSSHVVKDAKKKGFVAVASRGGAKRGLAIFDFLLRLAAIAVT IGAASVMYTAEETLPFFTQFLQFQAGYDDLPAFQYFVIAVAVVASYLVLSLPFSIVSIVR PHAVAPRLILLICDTLVVTLNTSAAAAAASITYLAHNGNQSTNWLPICQQFGDFCQNVST AVVADSIAILFFIVLIIISAIALKRH
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

full length protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage Condition

Store at -20°C, for extended storage, conserve at -20°C or -80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Regulates membrane-cell wall junctions and localized cell wall deposition. Required for establishment of the Casparian strip membrane domain (CSD) and the subsequent formation of Casparian strips, a cell wall modification of the root endodermis that determines an apoplastic barrier between the intraorganismal apoplasm and the extraorganismal apoplasm and prevents lateral diffusion.

Subcellular Location

Cell membrane; Multi-pass membrane protein. Note=Very restricted localization following a belt shape within the plasma membrane which coincides with the position of the Casparian strip membrane domain.

Protein Families

Casparian strip membrane proteins (CASP) family

Database Links

UNIGENE: At.42995

KEGG: ath:AT2G36100

STRING: 3702.AT2G36100.1

Promotions