ASTITLGEKTPMKEEDANQKKTENESTGGDAAGGNNKGDKGIASYWGVEPNKITKEDGSE WKWNCFRPWETYKADITIDLKKHHVPTTFLDRIAYWTVKSLRWPTDLFFQRRYGCRAMML ETVAAVPGMVGGMLLHCKSLRRFEQSGGWIKALLEEAENERMHLMTFMEVAKPKWYERAL VITVQGVFFNAYFLGYLISPKFAHRMVGYLEEEAIHSYTEFLKELDKGNIENVPAPAIAI DYWRLPADATLRDVVMVVRADEAHHRDVNHFASDIHYQGRELKEAPAPIGYH
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Catalyzes the cyanide-resistant oxidation of ubiquinol and the reduction of molecular oxygen to water, but does not translocate protons and consequently is not linked to oxidative phosphorylation. Increases respiration when the cytochrome respiratory pathway is restricted, or in response to low temperatures.
Gene References into Functions
AOX1A activation by Tricarboxylic acid cycle Intermediates 2-oxoglutarate and oxaloacetate.PMID:29208641
AOX isoforms are differentially activated and that activation at CysI and CysII is additive.PMID:28596420
MYB DOMAIN PROTEIN29 (MYB29) mutants have increased levels of ALTERNATIVE OXIDASE1a (AOX1a) transcript and protein compared to wild type after induction with antimycin A.PMID:28167700
Overexpression of AOX1a rescued the aox1a mutant phenotype, including the chlorophyll accumulation during greening and plastidial protein import.PMID:25158995
Phosphate deprivation increased NO production in WT roots, and the AOX level and the capacity of the alternative pathway to consume electrons in WT seedlings.PMID:26163703
AOX1A plays a significant role in sustaining the chloroplastic redox state and energization to optimize photosynthesis by regulating cellular redox homeostasis and ROS generation when electron transport through the COX pathway is disturbed at complex III.PMID:26292995
The authors propose a working model where AOX1a acts early in the response to Cd and activates or maintains a mitochondrial signalling pathway impacting on cellular antioxidative defence at the post-transcriptional level.PMID:25743159
RAO2/Arabidopsis NAC domain-containing protein17 (ANAC017) as a direct positive regulator of AOX1a. Plants with mutated rao2/anac017 were more stress sensitive.PMID:24045017
Arabidopsis plants deficient in AOX1a were unable to sustain photosynthesis under high light as is the case in WT plants.PMID:24560882
Overexpression of AOX1a reduced mitochondrial ROS production by maintaining the mitochondrial electron flux, and alleviated subsequent mitochondrial dysfunction and caspase-3-like activation in Al-induced programmed cell death.PMID:24863436
Foliar NO3 (-) assimilation was enhanced in both aox1a and ucp1 compared with the wild-type, suggesting that foliar NO3 (-) assimilation is probably driven by a decreased capacity of mAET and an increase in reductant within the cytosol.PMID:24799562
AOX and CET-PSI participate together in optimizing plant growth under conditions with elevated light intensity. [AOX1A]PMID:21707657
These results indicate that AOX is important for optimizing rates of photosynthetic CO(2) assimilation in response to rising CO(2) concentration.PMID:22848123
The ability of AOX1a and AOX2 to substitute for PTOX in the correct physiological and developmental contexts is a striking example of the capacity of a mitochondrial protein to replace the function of a chloroplast protein.PMID:22534126
These results suggest that AOX plays an important role in rapid acclimation of the respiratory chain to sHL, which may support efficient photosynthetic performance.PMID:21251020
When aox1a mutant seedlings were grown under a high-light condition, photobleaching was more evident in the mutant than the wild-type plants.PMID:20716069
AOX can play a critical role in cell re-programming under salinity stress.PMID:19941623
A 93 base pair portion necessary for induction was identified in the AtAOX1a promoter.PMID:16027972
AOX not only functions to prevent excess reactive oxygen species formation in whole tissues under stressful environmental conditions but also affects metabolism through more pervasive effects, including some that are extramitochondrial.PMID:16299170
a microarray study using an anti-sense line showed AOX1a influences outside mitochondria, particularly in chloroplasts and on several carbon metabolism pathwaysPMID:16299171
A variety of Cys(II) substitutions constitutively activated AtAOX1a, indicating that neither the catalytic site nor, unlike at Cys(I), charge repulsion is involved.PMID:16457775
AOX1a plants have a greatly altered stress response even when mitochondria or the mitochondrial electron transport chain are not the primary target of the stress and that AOX1a plays a broad role in determining the normal redox balance in the cellPMID:18424626
AOX is a necessary component in antioxidant defence mechanisms and for the control of a balanced metabolism.PMID:18507803
Show
More
Hide
All
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein. Note=Mitochondrial, possibly in the inner surface of the inner mitochondrial membrane.
Protein Families
Alternative oxidase family
Tissue Specificity
Expressed in roots, stems, cotyledons, leaves and flowers. High expression in sepals.