Recombinant Arabidopsis thaliana 4-hydroxybenzoate polyprenyltransferase, mitochondrial (PPT1)

Code: CSB-CF839067DOA
Size:
20μg
20μg100μg
US$5383
Quantity:
Express system: in vitro E.coli expression system
Species: Arabidopsis thaliana (Mouse-ear cress)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Target Names
PPT1
Uniprot NO.
Species
Arabidopsis thaliana (Mouse-ear cress)
Source
in vitro E.coli expression system
Expression Region
22-407
Target Protein Sequence
PSSSSALLQSQHKSLSNPVTTHYTNPFTKCYPSWNDNYQVWSKGRELHQEKFFGVGWNYR LICGMSSSSSVLEGKPKKDDKEKSDGVVVKEASWIDLYLPEEVRGYAKLARLDKPIGTWL LAWPCMWSIALAADPGSLPSFKYMALFGCGALLLRGAGCTINDLLDQDIDTKVDRTKLRP IASGLLTPFQGIGFLGLQLLLGLGILLQLNNYSRVLGASSLLLVFSYPLMKRFTFWPQAF LGLTINWGALLGWTAVKGSIAPSIVLPLYLSGVCWTLVYDTIYAHQDKEDDVKVGVKSTA LRFGDNTKLWLTGFGTASIGFLALSGFSADLGWQYYASLAAASGQLGWQIGTADLSSGAD CSRKFVSNKWFGAIIFSGVVLGRSFQ
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Catalyzes the prenylation of para-hydroxybenzoate (PHB) with an all-trans polyprenyl group. Mediates the second step in the final reaction sequence of coenzyme Q (CoQ) biosynthesis, which is the condensation of the polyisoprenoid side chain with PHB, generating the first membrane-bound Q intermediate. Required for embryo development.
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein; Matrix side.
Protein Families
UbiA prenyltransferase family
Tissue Specificity
Expressed in flowers.
Database Links

UNIGENE: At.2563

KEGG: ath:AT4G23660

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products