Home
Product
Protein
Transmembrane Proteins
Recombinant Aplysia californica Synaptotagmin-1 (SYT1)

Recombinant Aplysia californica Synaptotagmin-1 (SYT1)

Code: CSB-CF023029DNM

Rate （N/A）
Review （0）

Size:

20μg100μg

US$5697

Quantity:

Express system: in vitro E.coli expression system

Species: Aplysia californica (California sea hare)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

SYT1

Uniprot NO.

P41823

Species

Aplysia californica (California sea hare)

Source

in vitro E.coli expression system

Expression Region

1-428

Target Protein Sequence

MDSLLARVKRAADADALNPAQEGVTGGPDAAGLPDVSTSSPGGGGAGDKLKEKMDEYKDKLINEIENLPIWAIVLIIAGSLLFLVCCVYCVCRRSCRKRKKKEGKKGLKGAVDLKSVQLLGNSYKEKVQPDLDELPVNMEDNEDAESTKSEVKLGKLQFSLDYDFQKGELSVNVIQAADLPGMDMSGTSDPYVKVYLLPDKKKKYETKVHRKTLNPVFNESFTFKVPYAEVGSKILTFAVYDFDRFSKHDQIGQVQVPLNSIDLGRVVEDWKDLQSPDTESEKENKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIALLQGTKRLKKKKTTIKKNTLNPYFNESFGFEVPFEQIQKVTLIITVVDYDRIGTSEPIGRCVLGCNSSGTELRHWSDMLANPRRPIAQWHTLQEVPEKN
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

full length protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Acts as inhibitor of neurotransmitter release. Overexpression leads to a decrease in the amplitude of the excitatory postsynaptic potential in dissected cholinergic and glutaminergic neurons while depletion with antisense oligonucleotides leads to an increase. Overexpression of isoform 1 blocks the reversal of synaptic depression by serotonin in sensory neurons.

Subcellular Location

Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane; Single-pass membrane protein. Cell junction, synapse. Note=And vesicle-like structures.

Protein Families

Synaptotagmin family

Database Links

UNIGENE: Acl.341

Promotions