Abbreviation
Recombinant Human SLC7A11 protein (Active)
Purity
Greater than 90% as determined by SDS-PAGE.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human SLC7A11 at 2 μg/mL can bind Anti-SLC7A11 recombinant antibody (CSB-RA892171MA1HU), the EC50 is 9.452-13.79 ng/mL.
Research Area
Cell Biology
Alternative Names
(Amino acid transport system xc-)(Calcium channel blocker resistance protein CCBR1)(Solute carrier family 7 member 11)(xCT)
Species
Homo sapiens (Human)
Source
in vitro E.coli expression system
Expression Region
1-501aa
Target Protein Sequence
MVRKPVVSTISKGGYLQGNVNGRLPSLGNKEPPGQEKVQLKRKVTLLRGVSIIIGTIIGAGIFISPKGVLQNTGSVGMSLTIWTVCGVLSLFGALSYAELGTTIKKSGGHYTYILEVFGPLPAFVRVWVELLIIRPAATAVISLAFGRYILEPFFIQCEIPELAIKLITAVGITVVMVLNSMSVSWSARIQIFLTFCKLTAILIIIVPGVMQLIKGQTQNFKDAFSGRDSSITRLPLAFYYGMYAYAGWFYLNFVTEEVENPEKTIPLAICISMAIVTIGYVLTNVAYFTTINAEELLLSNAVAVTFSERLLGNFSLAVPIFVALSCFGSMNGGVFAVSRLFYVASREGHLPEILSMIHVRKHTPLPAVIVLHPLTMIMLFSGDLDSLLNFLSFARWLFIGLAVAGLIYLRYKCPDMHRPFKVPLFIPALFSFTCLFMVALSLYSDPFSTGIGFVITLTGVPAYYLFIIWDKKPRWFRIMSEKITRTLQIILEVVPEEDKL
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human SLC7A11 at 2μg/mL can bind Anti-SLC7A11 recombinant antibody (CSB-RA892171MA1HU), the EC50 is 9.452-13.79 ng/mL.
-
Loaded Anti-Human SLC7A11 Antibody (CSB-RA892171MA1HU) on 96-Flat plate, can bind Human SLC7A11, with an affinity constant of <1 pM as determined in BLI assay (Gator Prime).
Description
SLC7A11 (xCT) is the light-chain subunit of system xc⁻, a cystine/glutamate antiporter critically implicated in ferroptosis regulation, redox homeostasis, and tumor metabolic reprogramming. This full-length recombinant human SLC7A11 (1–501 aa), produced in an *E. coli* cell-free system with an N-terminal 10×His tag, provides a suitable basis for studying this challenging multi-pass membrane transporter outside a lipid bilayer context. Functional ELISA confirms binding activity against a recombinant anti-SLC7A11 antibody (CSB-RA892171MA1HU) with an EC₅₀ of 9.452–13.79 ng/mL when immobilized at 2 μg/mL, and SDS-PAGE analysis demonstrates greater than 90% purity, supporting use in antibody validation, sandwich ELISA development, protein–antibody interaction studies, and as a reliable positive control in immunoassay optimization. Researchers should note that endotoxin levels have not been tested, so additional endotoxin removal may be necessary for any cell-based downstream applications.