Advance your cardiovascular research with our high-quality Recombinant Human MFGE8 protein. Lactadherin, also known as MFGE8, plays a vital role in various biological processes such as apoptotic cell clearance, regulation of inflammation, and vascular homeostasis. Its involvement in these processes makes MFGE8 an essential protein to study for understanding cardiovascular and inflammatory diseases.
Our Recombinant Human MFGE8 protein represents the full length of the mature protein (24-387 amino acids) and is expressed in E. coli, ensuring efficient and reliable production. The N-terminal 6xHis-SUMO-tag guarantees effective purification without compromising the protein's structure or function. With a purity of greater than 90% as determined by SDS-PAGE, our Recombinant Human MFGE8 protein provides the quality and consistency required for your cardiovascular research. Choose this exceptional protein to boost the success of your experiments and uncover new insights into cardiovascular biology.
Could you pls indicate to me the endotoxin level (LAL, EU per mg) of your products.
LDICSKNPCHNGGLCEEISQEVRGDVFPSYTCTCLKGYAGNHCETKCVEPLGMENGNIANSQIAASSVRVTFLGLQHWVPELARLNRAGMVNAWTPSSNDDNPWIQVNLLRRMWVTGVVTQGASRLASHEYLKAFKVAYSLNGHEFDFIHDVNKKHKEFVGNWNKNAVHVNLFETPVEAQYVRLYPTSCHTACTLRFELLGCELNGCANPLGLKNNSIPDKQITASSSYKTWGLHLFSWNPSYARLDKQGNFNAWVAGSYGNDQWLQVDLGSSKEVTGIITQGARNFGSVQFVASYKVAYSNDSANWTEYQDPRTGSSKIFPGNWDNHSHKKNLFETPILARYVRILPVAWHNRIALRLELLGC
We are looking for sterile, no endotoxin Mfge8. Is this product available?
What is the endotoxin level of this lot? Do you product sterile MFGE8 (no endotoxin)?
Unfortunately, unless you can guarantee endotoxin removal we would not be able to accept the protein. We are looking for levels at zero but could accept <0.001 or in that region.
Email: support@cusabio.com
Distributors Worldwide