Recombinant Human HLA-DMA protein (HLA-DMA), partial

CSB-EP338892HU
Size:
20ug
20ug100ug1mg(1mg*1 or 500ug*2)
US$224
Quantity:
Express system: E.coli
Tag Info: N-terminal 6xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Orders can only be placed from within the U.S.

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Uniprot NO.
Research Area
Cardiovascular
Source
E.coli
Expression Region
27-233aa
Target Protein Sequence
VPEAPTPMWPDDLQNHTFLHTVYCQDGSPSVGLSEAYDEDQLFFFDFSQNTRVPRLPEFADWAQEQGDAPAILFDKEFCEWMIQQIGPKLDGKIPVSRGFPIAEVFTLKPLEFGKPNTLVCFVSNLFPPMLTVNWQHHSVPVEGFGPTFVSAVDGLSFQAFSYLNFTPEPSDIFSCIVTHEIDRYTAIAYWVPRNALPSDLLENVLC
Mol. Weight
27.4kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Description

The region for expressing recombinant Human HLA-DMA contains amino acids 27-233. This HLA-DMA protein is theoretically predicted to have a molecular weight of 27.4 kDa. This HLA-DMA recombinant protein is manufactured in e.coli. The N-terminal 6xHis tag was smoothly integrated into the coding gene of HLA-DMA, which enables a simple process of detecting and purifying the HLA-DMA recombinant protein in the following steps.

The human leukocyte antigen-DMA (HLA-DMA) protein is a non-classical MHC class II protein that is involved in the peptide-loading process onto MHC class II molecules. Specifically, HLA-DMA acts as a chaperone during the peptide-loading phase in the endosomal compartments of antigen-presenting cells (APCs). It associates with MHC class II molecules and catalyzes the exchange of peptides bound to the MHC class II binding groove. This peptide exchange mechanism allows for the loading of high-affinity peptides onto MHC class II molecules, optimizing the antigen presentation to CD4+ T cells. The HLA-DMA protein is crucial for the efficient presentation of antigens to CD4+ T cells, which, in turn, triggers appropriate immune responses against pathogens. Understanding the functions of HLA-DMA is essential for unraveling the complexities of antigen presentation and immune regulation.

Customer Reviews and Q&A

 Customer Reviews

Target Background

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products