Abbreviation
Recombinant Vaccinia virus OPG161 protein, partial
Purity
Greater than 85% as determined by SDS-PAGE.
Alternative Names
A33R; Protein A33
Species
Vaccinia virus (strain Copenhagen) (VACV)
Expression Region
57-185aa
Target Protein Sequence
VRLNQCMSANEAAITDAAVAVAAASSTHRKVASSTTQYDHKESCNGLYYQGSCYILHSDYQLFSDAKANCTAESSTLPNKSDVLITWLIDYVEDTWGSDGNPITKTTSDYQDSDVSQEVRKYFCVKTMN
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Tris-based buffer,50% glycerol
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Explore the viral mechanisms with our Recombinant Vaccinia virus A33R (OPG161). This product features Protein OPG161, a significant protein encoded by the A33R gene in the Vaccinia virus, strain Copenhagen. Protein OPG161 plays an essential role in virus morphogenesis and egress, contributing to the virulence and pathogenicity of the virus, thus offering a profound potential for virology and immunology research.
This recombinant Protein OPG161 encompasses a partial sequence, specifically the amino acid region from 57-185. It is expressed in Baculovirus and carries both N-terminal 10xHis and C-terminal Myc tags, providing an easy route for purification and detection procedures. The Recombinant Vaccinia virus A33R (OPG161) achieves a purity greater than 85%, as determined by SDS-PAGE, to ensure reliable results in your research. It is available in either liquid form or a lyophilized powder to accommodate a range of experimental setups. This product provides a unique opportunity to further understand viral pathogenesis and potentially develop effective antiviral strategies.