Recombinant Sheep Toll-like receptor 9 (TLR9)

Product Details

Abbreviation
TLR9
Purity
>85% (SDS-PAGE)
Target Names
TLR9
Uniprot NO.
Alternative Names
TLR9; Toll-like receptor 9; CD antigen CD289
Species
Ovis aries (Sheep)
Source
Yeast
Expression Region
25-815
Target Protein Sequence
QGTLPAFLPCELQPRGKVNCNWLFLKSVPRFSAGAPRANVTSLSLISNRIHHLHDSDFVH LSNLRVLNLKWNCPPAGLSPMHFPCRMTIEPNTFLAVPTLEELNLSYNGITTVPALPSSL VSLSLSRTSILVLGPTHFTGLHALRFLYMDGNCYYKNPCQQAVEVAPGALLGLGNLTHLS LKYNNLTEVPRRLPPSLDTLLLSYNHIITLAPEDLANLTALRVLDVGGNCRRCDHARNPC RECPKNFPKLHPDTFSHLSRLEGLVLKDSSLYKLEKDWFRGLGRLQVLDLSENFLYDYIT KTTIFRNLTQLRRLNLSFNYHKKVSFAHLQLAPSFGGLVSLEKLDMHGIFFRSLTNTTLR PLTQLPKLQSLSLQLNFINQAELSIFGAFPSLLFVDLSDNRISGAARPVAALGEVDSGVE VWRWPRGLAPGPLAAVSAKDFMPSCNLNFTLDLSRNNLVTIQQEMFTRLSRLQCLRLSHN SISQAVNGSQFVPLTRLRVLDLSYNKLDLYHGRSFTELPQLEALDLSYNSQPFSMQGVGH NLSFVAQLPSLRYLSLAHNGIHSRVSQKLSSASLRALDFSGNSLSQMWAEGDLYLCFFKG LRNLVQLDLSKNHLHTLLPRHLDNLPKSLRQLRLRDNNLAFFNWSSLTVLPQLEALDLAG NQLKALSNGSLPPGTRLQKLDVSSNSIGFVTPGFFVLANRLKELNLSANALKTVDPFWFG RLTETLKILDVSANPLHCACGAAFVDFLLEMQAAVPGLSRRVTCGSPGQLQGRSIFAQDL RLCLDETLSLD
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Extracellular domain
Tag Info
N-terminal His-tagged/Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Key component of innate and adaptive immunity. TLRs (Toll-like receptors) control host immune response against pathogens through recognition of molecular patterns specific to microorganisms. TLR9 is a nucleotide-sensing TLR which is activated by unmethylated cytidine-phosphate-guanosine (CpG) dinucleotides. Acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response. Upon CpG stimulation, induces B-cell proliferation, activation, survival and antibody production.
Gene References into Functions
  1. analysis indicated that the change of G to R at codon 520 of TLR9 polypeptide shows a significant association with Small Ruminant Lentivirus seropositivity PMID:23691111
  2. characterization of protein coding region of TLR9 gene; by analyzing presence of substitutions, we show intraspecies polymorphism and its possible implications, and attempt to define the association of discovered substitutions with maedi visna infection PMID:20875448
  3. Variation detected here might have an impact on the structure and/or function of TLR9 and hence affect the immune response to pathogens. PMID:17706295

Show More

Hide All

Subcellular Location
Endoplasmic reticulum membrane; Single-pass type I membrane protein. Endosome. Lysosome. Cytoplasmic vesicle, phagosome.
Protein Families
Toll-like receptor family
Database Links

UNIGENE: Oar.3273

KEGG: oas:494547

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1