Recombinant Sheep Somatotropin (GH1)

Code
MSDS	MSDS Datasheet
Size	Pls inquire
Source
Conjugate
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

>85% (SDS-PAGE)

Target Names

GH1

Uniprot NO.

P67930

Species

Ovis aries (Sheep)

Source

Yeast

Expression Region

28-217

Target Protein Sequence

FPAMSLSGLFANAVLRAQHLHQLAADTFKEFERTYIPEGQRYSIQNTQVAFCFSETIPAP TGKNEAQQKSDLELLRISLLLIQSWLGPLQFLSRVFTNSLVFGTSDRVYEKLKDLEEGIL ALMRELEDVTPRAGQILKQTYDKFDTNMRSDDALLKNYGLLSCFRKDLHKTETYLRVMKC RRFGEASCAF
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal His-tagged/Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage

Store at -20°C, for extended storage, conserve at -20°C or -80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Plays an important role in growth control. Its major role in stimulating body growth is to stimulate the liver and other tissues to secrete IGF-1. It stimulates both the differentiation and proliferation of myoblasts. It also stimulates amino acid uptake and protein synthesis in muscle and other tissues.

Gene References into Functions

Association analyses showed that both g.498G>C and g.616G>A GH polymorphisms were significantly associated with several growth traits (at P < 0.01 or P < 0.05) in three investigated sheep breeds. PMID:27706626
The effect leptin, orexin-A, and ghrelin on the secretion of luteinizing hormone (LH) and growth hormone by adenohypophyseal explants obtained from normally fed or fasted ewes during the breeding and nonbreeding seasons. PMID:24906931
The results showed that the growth hormone genotypes are associated with estimated breeding values of growth traits. PMID:21328104
The simultaneous increase of expression of hypothalamic NPY suggests NPY involvement in the regulation of psychoemotional stress through the somatotrophic axis in the female lambs. PMID:20675289
These data are consistent with the effects of LPS on GH secretion originating through peripheral cytokine presentation to the pituitary, as well as a potential to act directly on selective populations of pituitary cells via CD14. PMID:15899940
Results show that in comparison to the product of the ovine growth hormone (GH)2-N gene copy, the postulated product of the GH2-Z gene copy, the G9R/G63S mutein, has a higher affinity to the growth hormone receptor and elevated biological activity. PMID:17850798
Results describe thet pulsatility of cerebrospinal fluid and plasma ghrelin levels in relation to growth hormone secretion and food intake in the sheep, and the effects of exogenous ghrelin on GH and feeding behavior. PMID:18673413
study has demonstrated for the first time that ghrelin differentially modulates growth hormone secretory response to growth hormone-releasing hormone according to feeding states in ruminant animals PMID:19342191