Recombinant Severe acute respiratory syndrome coronavirus 2 Replicase polyprotein 1ab (rep), partial

In Stock
Code: CSB-MP3388GND
Size:
20ug
20ug100ug1mg
US$256
Quantity:
Express system: Mammalian cell
Species: Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2)
Tag Info: C-terminal hFc1-Flag-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Abbreviation
Recombinant SARS-CoV-2 Replicase polyprotein 1ab protein, partial
Purity
Greater than 90% as determined by SDS-PAGE.
Greater than 95% as determined by SEC-HPLC.
Target Names
rep
Uniprot NO.
Alternative Names
pp1ab;ORF1ab polyprotein
Species
Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2)
Source
Mammalian cell
Expression Region
4141-4253aa
Target Protein Sequence
NNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQ
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
44.5 kDa
Protein Length
Full Length
Tag Info
C-terminal hFc1-Flag-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • The purity of rep was greater than 95% as determined by SEC-HPLC

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Multifunctional protein involved in the transcription and replication of viral RNAs. Contains the proteinases responsible for the cleavages of the polyprotein.; Inhibits host translation by associating with the open head conformation of the 40S subunit. The C-terminus binds to and obstructs ribosomal mRNA entry tunnel. Thereby inhibits antiviral response triggered by innate immunity or interferons. The nsp1-40S ribosome complex further induces an endonucleolytic cleavage near the 5'UTR of host mRNAs, targeting them for degradation. Viral mRNAs less susceptible to nsp1-mediated inhibition of translation, because of their 5'-end leader sequence.; May play a role in the modulation of host cell survival signaling pathway by interacting with host PHB and PHB2. Indeed, these two proteins play a role in maintaining the functional integrity of the mitochondria and protecting cells from various stresses.; Responsible for the cleavages located at the N-terminus of the replicase polyprotein. Participates together with nsp4 in the assembly of virally-induced cytoplasmic double-membrane vesicles necessary for viral replication. Antagonizes innate immune induction of type I interferon by blocking the phosphorylation, dimerization and subsequent nuclear translocation of host IRF3. Prevents also host NF-kappa-B signaling. In addition, PL-PRO possesses a deubiquitinating/deISGylating activity and processes both 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains from cellular substrates. Cleaves preferentially ISG15 from antiviral protein IFIH1 (MDA5), but not DDX58 (RIG-I). Can play a role in host ADP-ribosylation by binding ADP-ribose.; Participates in the assembly of virally-induced cytoplasmic double-membrane vesicles necessary for viral replication.; Cleaves the C-terminus of replicase polyprotein at 11 sites. Recognizes substrates containing the core sequence Plays a role in the initial induction of autophagosomes from host reticulum endoplasmic. Later, limits the expansion of these phagosomes that are no longer able to deliver viral components to lysosomes. Binds to host TBK1 without affecting TBK1 phosphorylation; the interaction with TBK1 decreases IRF3 phosphorylation, which leads to reduced IFN-beta production.; Plays a role in viral RNA synthesis. Forms a hexadecamer with nsp8 (8 subunits of each) that may participate in viral replication by acting as a primase. Alternatively, may synthesize substantially longer products than oligonucleotide primers.; Plays a role in viral RNA synthesis. Forms a hexadecamer with nsp7 (8 subunits of each) that may participate in viral replication by acting as a primase. Alternatively, may synthesize substantially longer products than oligonucleotide primers. Interacts with ribosome signal recognition particle RNA (SRP). Together with NSP9, suppress protein integration into the cell membrane, thereby disrupting host immune defenses.; May participate in viral replication by acting as a ssRNA-binding protein. Interacts with ribosome signal recognition particle RNA (SRP). Together with NSP9, suppress protein integration into the cell membrane, thereby disrupting host immune defenses.; Plays a pivotal role in viral transcription by stimulating both nsp14 3'-5' exoribonuclease and nsp16 2'-O-methyltransferase activities. Therefore plays an essential role in viral mRNAs cap methylation.; Responsible for replication and transcription of the viral RNA genome.; Multi-functional protein with a zinc-binding domain in N-terminus displaying RNA and DNA duplex-unwinding activities with 5' to 3' polarity. Activity of helicase is dependent on magnesium. Binds to host TBK1 and inhibits TBK1 phosphorylation; the interaction with TBK1 decreases IRF3 phosphorylation, which leads to reduced IFN-beta production.; Enzyme possessing two different activities: an exoribonuclease activity acting on both ssRNA and dsRNA in a 3' to 5' direction and a N7-guanine methyltransferase activity. Acts as a proofreading exoribonuclease for RNA replication, thereby lowering The sensitivity of the virus to RNA mutagens.; Plays a role in viral transcription/replication and prevents the simultaneous activation of host cell dsRNA sensors, such as MDA5/IFIH1, OAS, and PKR. Acts by degrading the 5'-polyuridines generated during replication of the poly(A) region of viral genomic and subgenomic RNAs. Catalyzes a two-step reaction in which a 2'3'-cyclic phosphate (2'3'-cP) is first generated by 2'-O transesterification, which is then hydrolyzed to a 3'-phosphate (3'-P). If not degraded, poly(U) RNA would hybridize with poly(A) RNA tails and activate host dsRNA sensors.; Methyltransferase that mediates mRNA cap 2'-O-ribose methylation to the 5'-cap structure of viral mRNAs. N7-methyl guanosine cap is a prerequisite for binding of nsp16. Therefore plays an essential role in viral mRNAs cap methylation which is essential to evade immune system. May disrupt host mRNA splicing in nucleus by interacting with pre-mRNA Recognition Domains ofthe U1 and U2 snRNAs.
Subcellular Location
[Host translation inhibitor nsp1]: Host cytoplasm.; [Non-structural protein 2]: Host cytoplasm. Host endosome.; [Papain-like protease nsp3]: Host membrane; Multi-pass membrane protein. Host cytoplasm.; [Non-structural protein 4]: Host membrane; Multi-pass membrane protein. Host cytoplasm.; [3C-like proteinase nsp5]: Host cytoplasm. Host Golgi apparatus.; [Non-structural protein 6]: Host membrane; Multi-pass membrane protein.; [Non-structural protein 7]: Host cytoplasm, host perinuclear region. Host cytoplasm. Host endoplasmic reticulum.; [Non-structural protein 8]: Host cytoplasm, host perinuclear region. Host cytoplasm. Host endoplasmic reticulum.; [Non-structural protein 9]: Host cytoplasm, host perinuclear region. Host cytoplasm. Host endoplasmic reticulum.; [Non-structural protein 10]: Host cytoplasm, host perinuclear region. Host cytoplasm. Host endoplasmic reticulum.; [Proofreading exoribonuclease nsp14]: Host cytoplasm. Host endoplasmic reticulum. Host endoplasmic reticulum.; [Helicase nsp13]: Host endoplasmic reticulum-Golgi intermediate compartment.; [Uridylate-specific endoribonuclease nsp15]: Host cytoplasm, host perinuclear region.; [2'-O-methyltransferase nsp16]: Host nucleus. Host cytoplasm.

  Email: support@cusabio.com
  Distributors Worldwide

CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products