Recombinant Saccharomyces cerevisiae Cytosine deaminase (FCY1)

Code: CSB-EP613203SVG
Size:
20μg
20μg100μg1mg(1mg*1 or 500ug*2)
US$388
Quantity:
Express system: E.coli
Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Abbreviation
FCY1
Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
FCY1
Uniprot NO.
Research Area
Others
Alternative Names
FCY1; YPR062W; YP9499.17Cytosine deaminase; EC 3.5.4.1; Cytosine aminohydrolase
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Source
E.coli
Expression Region
1-158aa
Target Protein Sequence
MVTGGMASKWDQKGMDIAYEEAALGYKEGGVPIGGCLINNKDGSVLGRGHNMRFQKGSATLHGEISTLENCGRLEGKVYKDTTLYTTLSPCDMCTGAIIMYGIPRCVVGENVNFKSKGEKYLQTRGHEVVVVDDERCKKIMKQFIDERPQDWFEDIGE
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
25.0 kDa
Protein Length
Full Length
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Tris-based buffer,50% glycerol
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Description

Recombinant Saccharomyces cerevisiae Cytosine deaminase (FCY1) is expressed in E. coli and consists of the full-length protein from amino acids 1 to 158. This protein features both an N-terminal 10xHis-tag and a C-terminal Myc-tag, which help with purification and detection. The product shows a purity level greater than 85% as determined by SDS-PAGE, making it suitable for various research applications.

Cytosine deaminase is an enzyme that removes amino groups from cytosine to form uracil. This process appears to play a critical role in pyrimidine metabolism. The enzyme's activity draws particular interest from researchers studying metabolic pathways and enzyme mechanisms. As a key component in nucleotide metabolism, scientists frequently examine it in the context of genetic regulation and cellular processes.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Based on the provided information, the recombinant Saccharomyces cerevisiae Cytosine deaminase (FCY1) is expressed in E. coli. As a yeast enzyme, FCY1 is a relatively small (158 aa) metabolic protein that may not require complex eukaryotic-specific post-translational modifications for proper folding. E. coli expression systems can often successfully produce functional forms of such enzymes. However, enzymatic activity is critically dependent on precise folding to form the active site. The presence of both an N-terminal 10xHis-tag and a C-terminal Myc-tag could potentially interfere with the protein's structure or oligomerization. Since activity is unverified, the protein's folding state and bioactivity remain uncertain. While the probability of correct folding may be reasonable, it cannot be assumed without functional validation (e.g., an enzyme activity assay).

1. Antibody Development and Immunoassay Optimization

This application is generally suitable. The recombinant FCY1 can serve as an effective immunogen for generating antibodies, as antibodies often recognize linear epitopes. The dual tags facilitate purification and detection in assays like Western blot or ELISA. The >85% purity is adequate for immunization. However, it should be noted that if the protein is misfolded, antibodies generated may not recognize the native, functionally folded FCY1 in yeast cells. Validation against native FCY1 is recommended.

2. Protein-Protein Interaction Studies

This application is highly dependent on correct folding. The dual tags are technically convenient for pull-down assays. However, if FCY1 is misfolded, its ability to interact with genuine biological partners involved in nucleotide metabolism will be compromised, potentially leading to the identification of non-physiological interactions. The full-length sequence is advantageous, but results are only reliable if the protein is natively folded. This application should be considered high-risk without prior activity confirmation.

3. Biochemical Characterization and Enzyme Kinetics Studies

This application is appropriate, but its purpose must be clarified. The protein can be used to develop and optimize assay protocols (e.g., spectrophotometric methods). However, if the goal is to study kinetics (e.g., determine Km, kcat), this is only valid if the protein is enzymatically active. Without activity confirmation, "enzyme kinetics studies" are not feasible. The initial experiments must focus on testing for activity before any kinetic parameters can be meaningfully measured. The protein can serve as a standard only if its activity is quantified first.

4. Comparative Proteomics and Cross-Species Analysis

This application is suitable for structural and expression-level comparisons. The defined tags allow for consistent detection and quantification when comparing expression across systems or with homologs. This use is less dependent on native activity, as it can focus on physical properties (size, stability, antibody reactivity). However, for "functional conservation studies," activity must be confirmed.

Final Recommendation & Action Plan

The critical first step is to determine if the recombinant FCY1 is correctly folded and active. A functional assay measuring the conversion of cytosine to uracil must be performed. If active, the protein can be used for all described applications, with kinetic studies becoming particularly valuable. If inactive, focus should shift to applications that do not require native conformation, such as antibody development (for linear epitopes) and comparative proteomics. For protein-protein interaction studies, activity is a prerequisite. The biochemical characterization studies should be initiated immediately to assess folding (e.g., via size-exclusion chromatography, circular dichroism) and to test for basic enzymatic function, which will guide all subsequent use cases.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Catalyzes the hydrolytic deamination of cytosine to uracil or 5-methylcytosine to thymine. Is involved in the pyrimidine salvage pathway, which allows the cell to utilize cytosine for pyrimidine nucleotide synthesis.
Gene References into Functions
  1. Cytosine deaminase residue glutamate64 plays a critical role in the activation of anticancer prodrug 5-fluorocytosine, indicating importance not only for the deamination reaction but also for binding of the substrate. PMID:22208667

Show More

Hide All

Subcellular Location
Cytoplasm. Nucleus.
Protein Families
Cytidine and deoxycytidylate deaminase family
Database Links

KEGG: sce:YPR062W

STRING: 4932.YPR062W

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products