Recombinant Rat Vasopressin V1a receptor (Avpr1a), partial

Code: CSB-RP156244r
Size:
20μg
20μg100μg1mg(1mg*1 or 500ug*2)
US$306
Quantity:
Express system: E.coli
Species: Rattus norvegicus (Rat)
Tag Info: N-terminal GST-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Avpr1a
Uniprot NO.
Research Area
Others
Alternative Names
Avpr1aVasopressin V1a receptor; V1aR; AVPR V1a; Antidiuretic hormone receptor 1a; Vascular/hepatic-type arginine vasopressin receptor
Species
Rattus norvegicus (Rat)
Source
E.coli
Expression Region
7-52aa
Target Protein Sequence
SQDRSVGNSSPWWPLTTEGSNGSQEAARLGEGDSPLGDVRNEELAK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
31.9kDa
Protein Length
Partial
Tag Info
N-terminal GST-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Receptor for arginine vasopressin. The activity of this receptor is mediated by G proteins which activate a phosphatidyl-inositol-calcium second messenger system. Involved in social memory formation.
Gene References into Functions
  1. data support a role for altered signalling via central Avpr1a in PreNatal Stress-induced sex-dependent changes in social memory. PMID:26613552
  2. Increased expression of V1aR in hypothalamic paraventricular nucleus influences autonomic cardiovascular regulation and demarcates vulnerability to stress. PMID:27810519
  3. Vasopression V1a receptor binding density was higher in juveniles than in adults in regions associated with reward and socio-spatial memory and higher in adults than in juveniles in key regions of the social decision-making network and in cortical regions. PMID:27389643
  4. Vasopressin V1A receptors mediate the beneficial effects of hypercapnia on microcirculatory oxygenation during sepsis. PMID:26969105
  5. Stimulation of V1a receptor induces the downregulation of GLUT9, reabsorption urate transporter, together with the upregulation of ABCG2 and NPT1, secretion urate transporters, all changes of which clearly lead to increase in renal uric acid clearance. PMID:26935049
  6. This study demonstrated that Vasopressin V1a receptor within the PVN of lactating rats mediate maternal care and anxiety-related behaviour. PMID:26909846
  7. The combination of V1aR and V2R antagonists prevented cardiac/renal damage in rat model of hypertensive heart failure. PMID:26248278
  8. AVP plays an important role in modulating the salt-induced sympathoexcitation and high blood pressure, via V1a receptors, within the paraventricular nucleus of male rats. PMID:26354848
  9. Myocardial infarction and chronic stress cause significant but differential changes in the regulation of V1a receptors expression in the brain and the kidney. PMID:25169016
  10. Oxytocin inhibits ASICs through V1A receptors in sensory neurons modulating nociception and pain. PMID:24641084
  11. Mice lacking V1a receptors have less secondary brain damage following experimental traumatic brain injury. PMID:23441636
  12. These data suggest that in SHR rats, activation of plasma AVP and the renal V(1A) receptor occurs during developing hypertension, with downregulation when hypertension is established. PMID:23246465
  13. vasopressin V(1a) receptors exert a modulatory influence on the neural response to a predator odor PMID:23219972
  14. High extracellular glucose downregulates vasopressin V1A receptors on rat mesangial cells and modulates their signal transduction properties via protein kinase (PK)C activation. PMID:22352691
  15. The data showed that activation of arginine vasopressin V1a receptors by arginine vasopressin in the lateral septum is important for social recognition in both sexes, and that the roles of septal V1a receptors in social recognition change during aging. PMID:22033278
  16. V1a vasopressin receptor mRNA and protein expressions are significantly down-regulated in cerebellum from post-infarct heart failure; they are not affected by mild chronic stressing. PMID:21652017
  17. The results of this study suggested that, in humans, vasopressin, acting on V1AR, produces inhibition of capsaicin-induced pain by activating endogenous (stress induced) analgesic systems. PMID:22019732
  18. V(A)R plays a physiological role in preventing urine leakage. PMID:21228111
  19. Aldosterone requires vasopressin V1a receptors on intercalated cells to mediate acid-base homeostasis. PMID:21415155
  20. Spinal V1a receptors are not required for elevations of mean arterial pressure under conditions of acute or chronic osmotic stress in conscious rats. PMID:21123759
  21. V(1a) receptor plays an important role in argipressin-mediated regulation of vascular reactivity and calcium sensitivity following hemorrhagic shock. PMID:19577256
  22. central V(1)Rs are involved in potentiation of cardiovascular responses to acute stress in chronically stressed rats, infarcted rats, and chronically stressed infarcted rats PMID:20042688
  23. mRNA expression for V(1a) and V(1b) AVP receptors in isolated rat adrenal chromaffin cells treated with vasopressin PMID:12047911
  24. Activation of V1A vasopressin receptor induces a rise of both cytoplasmic and nuclear calcium in cultured cortical astrocytes. PMID:12088846
  25. compared expression of V1a, V1b and V2 vasopressin receptor mRNA in the renal cortex, renal medulla and the heart of hypertensive renin transgenic TGR(mRen2)27 rats (TGR) and of their parent normotensive Sprague Dawley (SD) strain PMID:12369733
  26. the presence of vasopressin V1a receptors on gonadotropes supports the controversial hypothesis of a local direct action of the neuropeptide on this cell type PMID:12399435
  27. Increased amounts of renal cortex V1A receptors in spontaneously hypertensive rats play an important role in the pathophysiology of hypertension. PMID:12566855
  28. Vasopressin binding sites of the V1a receptor type are present in all laminae of the central gray at all segmental levels, whereas oxytocin binding sites are found only in the superficial layers of the dorsal horn. PMID:12752783
  29. CsA-induced superoxide generation is causally involved in vasopressin type 1A receptor expression and low physiological concentrations of radicals are able to directly affect cellular signaling to increase Avpr1a expression in aortic smooth muscle cells. PMID:12923165
  30. Ca(2+) increase induced by vasopressin was correlated with the number of V1a receptors. PMID:12971956
  31. No significant changes either in V(1a) receptor mRNA or protein levels were observed in pregnancy suggesting variations in the hypothalamic V(1a) receptor expression levels alone cannot account for the endogenous antipyresis observed at term PMID:14552875
  32. that the V(1a) receptor is increased at protein and mRNA level during development of hypertension in SHR rats but is normalized when hypertension is established. PMID:15075196
  33. during specific physiological states, pituicyte V(1a) receptor activation modulates the release of neurohypophysial hormones. PMID:15089968
  34. V(1a)-mediated arginine-vasopressin actions may influence LHRH release via cells in the immediate vicinity of LHRH neurones and/or via oestrogen-regulated cells in the anteroventral periventricular nucleus. PMID:15189327
  35. A vasopressinergic pathway projects to the lateral area of the ventrolateral medulla (VLM) and modulates cardiopulmonary functions via AVP V1A receptors on neurons within the lateral VLM. PMID:15239592
  36. AVP acts through V1a receptors and is involved in endogenous central histamine-induced reversal of critical haemorrhagic hypotension in rats PMID:15241560
  37. Rats with experimental renovascular hypertension manifest significantly higher expression of V1aR mRNA in the preoptic brain region in comparison to sham operated rats. PMID:15613739
  38. V(1a) vasopressin receptor binding in several forebrain areas seems to be affected by brief periods of social interactions, and, in the lateral septum, it also appears to be related to dominance status. PMID:16154572
  39. altered reactivity to V1A of V1 receptor in the superior mesenteric and/or hindquarter vascular regions of SHR PMID:16398053
  40. The results provide evidence for enhanced engagement of the brain V1 VP receptors in regulation of resting MABP and in generation of exaggerated cardiovascular responses to air jet stress during the post-infarct state. PMID:16423716
  41. Our findings demonstrate the importance of vasopressin acting on spinal V(1a) receptors for mediating sympathoexcitatory response to acute salt loading. PMID:16873404
  42. Expression of the V(2)R is downregulated via V(1a)R pathway in LLC-PK(1)/rV(1a)R cells, and expression of V(2)R is downregulated by PMA-induced PKC pathway and upregulated by cAMP-PKA pathway. PMID:17213462
  43. renal collecting duct cells Arginine-vasopressin selectively activates, via a complex of V1 and V2 receptor-mediated actions PMID:17762181
  44. Modulation by vasopressin of the lateral septal circuitry may be part of the neuronal mechanism by which the peptide, acting via V(1A) receptors, promotes social recognition. PMID:17970727
  45. Results show that both Avpr1a and b are involved in anxiety-related responses, and suggest that different fear responses are under the control of specific AVP receptor systems within discrete parts of the hippocampus. PMID:18508119
  46. Oxytocin-induced contractions within rat and rabbit ejaculatory tissues are mediated by vasopressin V1A receptors and not oxytocin receptors. PMID:18552879
  47. The counteractivity of V2R and V1aR could be required to maintain minimum urine volume in the dehydrated state PMID:18701631
  48. findings support the concept that dendritic release of VP from magnocellular neurons within the PVN mediates, at least in part, the pressor response to ET(A) receptor activation at the SFO. PMID:19258664
  49. Low pH stimulates vasopressin V2 receptor promoter activity and enhances downregulation induced by V1a receptor stimulation. PMID:19587140
  50. V1/V2 Vasopressin receptor antagonism potentiates the renoprotection of renin-angiotensin system inhibition in rats with renal mass reduction. PMID:19625993

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein. Cytoplasmic vesicle membrane; Multi-pass membrane protein. Note=Located in cytoplasmic vesicles dispersed throughout the cell cytoplasm and to the plasma membrane.
Protein Families
G-protein coupled receptor 1 family, Vasopressin/oxytocin receptor subfamily
Tissue Specificity
Localized within gonadotropes of the anterior pituitary of the brain. Broadly distributed throughout the cerebral cortex.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products