Home
Product
Protein
Recombinant Proteins
Recombinant Rat TGF-beta receptor type-1 (Tgfbr1), partial

Recombinant Rat TGF-beta receptor type-1 (Tgfbr1), partial

Code
MSDS	MSDS Datasheet
Size	Pls inquire
Source
Conjugate
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

>85% (SDS-PAGE)

Target Names

Tgfbr1

Uniprot NO.

P80204

Alternative Names

Tgfbr1; TGF-beta receptor type-1; TGFR-1; EC 2.7.11.30; Serine/threonine-protein kinase receptor R4; SKR4; TGF-beta type I receptor; Transforming growth factor-beta receptor type I; TGF-beta receptor type I; TbetaR-I

Species

Rattus norvegicus (Rat)

Source

Yeast

Expression Region

30-124

Target Protein Sequence

LQCFCHLCTKDNFTCETDGLCFVSVTETTDKVIHNSMCIAEIDLIPRDRPFVCAPSSKTG AVTYCCNQDHCNKIELPTTGPFSEKQSAGLGPVEL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

Partial

Tag Info

N-terminal His-tagged/Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage Condition

Store at -20°C, for extended storage, conserve at -20°C or -80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Transmembrane serine/threonine kinase forming with the TGF-beta type II serine/threonine kinase receptor, TGFBR2, the non-promiscuous receptor for the TGF-beta cytokines TGFB1, TGFB2 and TGFB3. Transduces the TGFB1, TGFB2 and TGFB3 signal from the cell surface to the cytoplasm and is thus regulating a plethora of physiological and pathological processes including cell cycle arrest in epithelial and hematopoietic cells, control of mesenchymal cell proliferation and differentiation, wound healing, extracellular matrix production, immunosuppression and carcinogenesis. The formation of the receptor complex composed of 2 TGFBR1 and 2 TGFBR2 molecules symmetrically bound to the cytokine dimer results in the phosphorylation and the activation of TGFBR1 by the constitutively active TGFBR2. Activated TGFBR1 phosphorylates SMAD2 which dissociates from the receptor and interacts with SMAD4. The SMAD2-SMAD4 complex is subsequently translocated to the nucleus where it modulates the transcription of the TGF-beta-regulated genes. This constitutes the canonical SMAD-dependent TGF-beta signaling cascade. Also involved in non-canonical, SMAD-independent TGF-beta signaling pathways. For instance, TGFBR1 induces TRAF6 autoubiquitination which in turn results in MAP3K7 ubiquitination and activation to trigger apoptosis. Also regulates epithelial to mesenchymal transition through a SMAD-independent signaling pathway through PARD6A phosphorylation and activation.

Gene References into Functions

a novel role for SREBP-1 as a cell surface retention factor for TbetaRI in mesangial cells, is reported. PMID:27826032
This study demonstrated that Transcutaneous auricular vagus nerve stimulation regulates expression of growth differentiation factor 11 and activin-like kinase 5 in cerebral ischemia/reperfusion rats. PMID:27653860
miR-22 acts as a novel negative regulator of angiotensin II-induced cardiac fibrosis by suppressing the expression of TGFbetaRI in the heart. PMID:27997889
The expressions of TGF-beta 1, TbetaRI, and TbetaRII in LPD and LPD + KA groups were significantly lower than those in NPD group and lower in LPD + KA group than those in LPD group PMID:26788514
Renal fibrosis resulting from excessive accumulation of extracellular matrix mainly driven by TGF-beta1 is dependent on the regulation of transforming growth factor receptor 1 expression by let-7b. PMID:24088962
cocaine self-administration resulted in an increase in TGF-beta R1 protein expression PMID:24386286
Despite long-term obstruction injury, inhibition of TGF-betaRII and ALK5 core fucosylation ameliorated the progression of renal fibrosis, an effect independent of TGF-betaRII and ALK5 expression. PMID:23486519
inhibiting ALK5 signaling in vitro antagonized the TGFbeta1-induced increase in astrocyte generation and antagonizing ALK5 signaling in vivo similarly inhibited astrogliogenesis within the SVZ during recovery from hypoxia-ischemia injury PMID:20221422
These findings suggest that TGF-beta signaling via ALK5 plays a critical role in maintaining heart valve integrity. PMID:21859884
TGF-beta1 caused apoptosis of pulmonary microvascular endothelial cell, an effect that was also dependent on ALK5 activity. PMID:19270180
These results suggest that AT1 inhibition in the developing kidney impairs renal growth and development and modulates the expression of ALK-5 and TbetaRII. PMID:16897002
Differential expression of TGF-beta type I and II receptors by pulmonary cells in bleomycin-induced lung injury correlate with repair and fibrosis, with reduced Tgfbr1 expression occurring during the early (days 4-7) stage of increased cell proliferation. PMID:11936776
results reveal that estrogen may directly modulate expression of transforming growth factor receptor type I mRNA in the hypothalamus PMID:12097811
Tgfbr1 had a marked yet transient upregulation in glomerular cells in experimental glomerulonephritis. PMID:12545247
TGF-beta type I receptor expression is suppressed by differentiated osteoblasts , when exposed to TGF-beta. PMID:16806744
Renal expression of mRNA is lower after tacroimus than in cyclosporine administration. PMID:16980036
Transforming growth factor beta receptor 1 were obviously expressed in primitive pulmonary alveolus, showing it plays an important regulatory role in the development of rat embryo and embryonic lung, especially in organic morphodifferentiation. PMID:17428384
These results indicate that high plasma cholesterol levels may contribute to the pathogenesis of certain diseases (e.g., atherosclerosis) by suppressing TGF-beta responsiveness. PMID:17972267
Early MMP-9 activation precedes the increase of TGF-beta signaling, and overt vascular elastocalcinosis and stiffness. PMID:18292396
The roles played by the ecto/transmembrane (ecto/TM) domains and endodomains of RI and RII TGF-beta receptors in these processes by transfecting 293 or HeLa cells with different combinations of receptor mutants, was analysed. PMID:18598696
Inhibition of TGF-beta signaling via activin receptor-like kinase-5 prevents development and progression of pulmonary hypertension in the monocrotaline model and may involve inhibition of pulmonary artery smooth muscle cell migration PMID:19153267