Recombinant Rat Solute carrier family 2, facilitated glucose transporter member 1 (Slc2a1), partial

In Stock
Code: CSB-EP319259RA
Size:
20ug
20ug100ug1mg(1mg*1 or 500ug*2)
US$388
Quantity:
Express system: E.coli
Species: Rattus norvegicus (Rat)
Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Slc2a1
Uniprot NO.
Research Area
Cancer
Alternative Names
(Glucose transporter type 1, erythrocyte/brain)(GLUT-1)
Species
Rattus norvegicus (Rat)
Source
E.coli
Expression Region
207-271aa
Target Protein Sequence
CPESPRFLLINRNEENRAKSVLKKLRGTADVTRDLQEMKEEGRQMMREKKVTILELFRSPAYRQP
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
15.2 kDa
Protein Length
Partial
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Facilitative glucose transporter, which is responsible for constitutive or basal glucose uptake. Has a very broad substrate specificity; can transport a wide range of aldoses including both pentoses and hexoses. Most important energy carrier of the brain: present at the blood-brain barrier and assures the energy-independent, facilitative transport of glucose into the brain. In association with BSG and NXNL1, promotes retinal cone survival by increasing glucose uptake into photoreceptors.
Gene References into Functions
  1. Increased Rat Placental Fatty Acid, but Decreased Amino Acid and Glucose Transporters Potentially Modify Intrauterine Programming PMID:26590355
  2. The data of this study provided evidence that histone deacetylation may contribute toward the loss of GLT-1 PMID:26953753
  3. Increased GLUT1 expression was observed together with overproduction of NO and pronounced liver injury in severely hyperglycaemic rats. GLUT1 overexpression might be implicated in the toxic effects of glucose in the liver. PMID:26347179
  4. The GLUT1 plays a role in regulation of ROS and could contribute to maintenance of insulin action in the presence of ROS. PMID:25101238
  5. In the cerebral cortex, GLUT1 increased at 18 h postexercise. PMID:24610532
  6. Ezrin is down-regulated in diabetic kidney glomeruli and regulates actin reorganization and glucose uptake via GLUT1 PMID:24726496
  7. Ascorbic acid markedly upregulated the basal expression of GLUT1 in endothelial cells of nondiabetic and diabetic cortex, which did not affect total ascorbic acid levels in the cortex. PMID:24739976
  8. Hypothalamic GLUT1 mRNA abundance increases with age and is sexually dimorphic PMID:24382486
  9. The expression of glut1 and glut4 in brain areas was not down-regulated, however, we observed trend to phase advance in glut1 expression in the cerebellum. PMID:24329691
  10. The aim of the work was to evaluate GLUT1 and GLUT2 in kidneys of an animal model of metabolic syndrome. PMID:24062089
  11. GLUT1 content is reduced in kidney cortex in diabetic hypertensive rats after blockade of the renin-angiotensin system, a phenomenon not specifically related to decreased blood pressure levels. PMID:23680377
  12. The Akt/TSC/mTOR/S6K signaling pathway may be one of the mechanisms underlying the upregulation of GLUT1 expression in uremic vascular smooth muscle cells. PMID:23265586
  13. CoCl(2) can increase mRNA expressions of GLUT1 and GLUT3 and glucose transporter activity of neurons in hypoxic conditions. PMID:12506324
  14. that n-3 deficiency repressed GLUT1 gene expression in the cerebral cortex PMID:22579067
  15. Progesterone could increase the tolerance of neurons to hypoxic-ischemia by up-regulating GLUT1 and GLUT3 expression. PMID:21141602
  16. We found that although cocaine withdrawal decreases GLT1 expression in both core and shell of the nucleus accumbens, only in core is GLT1 downregulation sensitive to both access and withdrawal PMID:22433294
  17. Data suggest that triiodothyronine (T3) up-regulates Glut1 and Glut3 in osteoblasts; thus, increased glucose uptake induced by T3 may be mediated by these high-affinity glucose transporters. PMID:22258767
  18. The expression of GLUT4 was lower in older animals, but no relation between age and GLUT1 expression was found. PMID:22125125
  19. During status epilepticus GLUT1 expression is increased throughout the brain between 1 and 12 hours, occurring more strongly in adult rats. PMID:21624469
  20. GLUT1 enhances mTOR activity independently of TSC2 and AMPK. PMID:21613414
  21. GLUT1 expression was statistically unchanged on the ketogenic diet. PMID:21605500
  22. Sustained hyperglycemia impairs hypothalamic glucose sensing to lower glucose production through changes in hypothalamic glial GLUT1. Data highlight the critical role of hypothalamic glial GLUT1 in mediating glucose sensing to regulate glucose production. PMID:21562080
  23. Results indicate that CHAs(OH) and water use a common translocation pathway in GLUT1 that is different to that of glucose transport. PMID:21069159
  24. Increased podocyte GLUT1 expression in diabetic mice does not contribute to early diabetic nephropathy. It protects against mesangial expansion and fibronectin accumulation possibly by blunting podocyte VEGF increases. PMID:20375116
  25. The mRNA and protein expression of GLUT1 in brain tissue increased significantly after hypoxic-ischemia. PMID:19950593
  26. GLUT1 and GLUT3 expression was notably up-regulated in the penumbra region after cerebral ischemia. PMID:19781384
  27. gene expression regulation by Sp1 in differentiating trophoblasts PMID:11689000
  28. Enhanced placental GLUT1 and GLUT3 expression in dexamethasone-induced fetal growth retardation PMID:11738800
  29. abundant in the occludin-positive endothelial cells of the nasal olfactory mucosa PMID:11751462
  30. Glucose deprivation and hypoxia increase the expression of the GLUT1 glucose transporter via a specific mRNA cis-acting regulatory element. PMID:11906001
  31. Glut1 is localized in astrocytic processes around axonal or dendritic elements of glutamatergic axo-dendritic synaptic junctions in the frontoparietal somatosensory cortex. PMID:11950769
  32. Lactate-induced translocation of GLUT1 and GLUT4 is not mediated by the phosphatidyl-inositol-3-kinase pathway in the rat heart. PMID:12002265
  33. Glucose transport was associated with enhanced accessibility of GLUT1 to its substrate and with photolabelling of formerly 'cryptic' exofacial substrate binding sites in GLUT1 molecules. PMID:12006627
  34. Gene expression in the jejunum in response to insulin-like growth factors in rat pups. PMID:12388463
  35. GLUT1 protein localised to the cytoplasm and basolateral surface of mammary epithelial cells in lactating rats PMID:12483288
  36. Insulin-induced translocation of facilitative glucose transporters in fetal/neonatal rat skeletal muscle PMID:12531786
  37. Upregulation of GLUT-1 expression: Link between hemodynamic and metabolic factors in glomerular hypertension? PMID:12771048
  38. upregulation of GLUT1 serves a role in agonist-induced hypertrophy and survival which can be dissociated from its role in glucose transport PMID:14519432
  39. A close correlation was found between local MCT1 and local GLUT1 densities. As local GLUT1 densities reflect local glucose metabolism in the brain, we conclude that local MCT1 densities are adjusted to local glucose metabolism and transport. PMID:14729246
  40. Glucose uptake by way of 2-deoxyglucose and GLUT-1 transporter protein content was measured in basal and insulin-stimulated skeletal muscle cells. PMID:14741039
  41. TATA box in the promoter of the GLUT1 gene is required by the agonist to activate transcription from the promoter. PMID:15808844
  42. GLUT1 and GLUT8 are both expressed in prepubertal testis, but only GLUT1 is regulated by l-triiodothyronine (T(3)); also found that the effect of T(3) cannot be attributed to its action on GLUT1 promoter PMID:15811071
  43. The impact on urinary TGF-beta1 occurs when diabetes and hypertension are associated, suggesting an effect that is triggered in the presence of GLUT1 overexpression and hyperglycemia. PMID:15855808
  44. Levels of both GLUT1 and GLUT12 are elevated in animal models of hypertension and diabetic nephropathy. PMID:16091581
  45. Decreased glucose utilization in the cerebral cortex of (n-3) PUFA-deficient rats is due to reduced amounts of the 2 isoforms of GLUT1, indicating post-transcriptional regulation of GLUT1 synthesis. PMID:16140905
  46. Data show that the consensus Sp1 site located in the rat proximal glucose transporter (Glut)1 promoter is necessary and sufficient for basal expression of the Glut1 gene, as well as for its response to hyperosmolarity. PMID:16162661
  47. Findings suggest the presence of GLUT1 in detergent-resistant membrane domains of spermatogenic cells, and support a role for caveolae in relation to glucose uptake and glucose phosphorylation. PMID:16419038
  48. susceptibility to diabetic glomerulopathy in MNS rats is associated with increased GLUT1-dependent glucose transport activity in response to hyperglycaemia and/or TGF-beta, which may amplify ECM overproduction. PMID:16449286
  49. results indicate that AQP4 may play a much more important role in blood-brain barrier function than GLUT-1, and thereby also in water distribution in the cerebral cortex of stroke-prone spontaneously hypertensive rats with severe hypertension PMID:16461188
  50. the regulation of GLUT1 and GLUT3 in cerebral cortex is regulated by T(3)and the expression of glucose transporters induced by hypothyroidism might have a functional impact on brain glucose uptake. PMID:16581179

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein. Photoreceptor inner segment.
Protein Families
Major facilitator superfamily, Sugar transporter (TC 2.A.1.1) family, Glucose transporter subfamily
Tissue Specificity
Detected in osteoblastic cells (at protein level). Detected in brain, and at lower levels in kidney, heart and lung.
Database Links

UNIGENE: Rn.3205

KEGG: rno:24778

STRING: 10116.ENSRNOP00000061340

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products