Recombinant Rat Oncostatin-M (Osm)

Code
MSDS
Size Pls inquire
Source
Conjugate
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Abbreviation
Osm
Purity
>85% (SDS-PAGE)
Target Names
Osm
Uniprot NO.
Alternative Names
Osm; Oncostatin-M; OSM
Species
Rattus norvegicus (Rat)
Source
E.coli
Expression Region
26-208
Target Protein Sequence
KRGCSSSSPKLLSQLKSQANITGNTASLLEPYILHQNLNTLTLRAACTEHPVAFPSEDMLRQLSKPDFLSTVHATLGRVWHQLGAFRQQFPKIQDFPELERARQNIQGIRNNVYCMARLLHPPLEIPEPTQADSGTSRPTTTAPGIFQIKIDSCRFLWGYHRFMGSVGRVFEEWGDGSRRSRR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal His-tagged/Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Growth regulator. Inhibits the proliferation of a number of tumor cell lines. It regulates cytokine production, including IL-6, G-CSF and GM-CSF from endothelial cells. Uses only type II OSM receptor (heterodimers composed of OSMR and IL6ST). Involved in the maturation of fetal hepatocytes, thereby promoting liver development and regeneration.
Gene References into Functions
  1. OSM is a key mediator for inducing differentiation of OC15-5 cells into hepatocytes PMID:15743783
  2. In the immortalized mouse and primary cultured proliferative rat hepatocytes, treatment with OSM markedly increased mRNA and protein of claudin-2 together with formation of developed networks of TJ strands. PMID:17434483
  3. OSM may not only play a role in the regulation of Sertoli cell proliferation and the initiation of spermatogenesis but may also play a role in the regulation of Leydig cell progenitor formation. PMID:17996055
  4. Results indicate that osteosarcoma cells stably producing OSM do not develop resistance to this cytokine and thus could be a valuable new tool to study the anti-cancer effect of OSM in vivo. PMID:19168167

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
LIF/OSM family
Tissue Specificity
Widely expressed. Expressed at higher levels in liver, skin and spleen.
Database Links

  Email: support@cusabio.com
  Distributors Worldwide

CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1