Recombinant Rat Mesothelin (Msln)

Product Details

Abbreviation
Msln
Purity
>85% (SDS-PAGE)
Target Names
Msln
Uniprot NO.
Alternative Names
Msln; Erc; Mpf; Mesothelin; Pre-pro-megakaryocyte-potentiating factor; Protein expressed in renal carcinoma) [Cleaved into: Megakaryocyte-potentiating factor; MPF); Mesothelin; cleaved form]
Species
Rattus norvegicus (Rat)
Source
Yeast
Expression Region
298-600
Target Protein Sequence
DTEQKACPPGKEPNVVDENLIFYQNWELEACVDGTLLAGQMDLVNEIPFTYEQLSIFKHKLDKTYPQGYPESLIKQLGHFFRYVSPEDIRQWNVTSPDTVNTLLKVSKGQKMDAQVIALVACYLRGGGKLDEDIVKALDNIPLSYLCDFSPQDLHAIPSSVMWLVGLHDLDKCSQRHLGILYQKACSAFQNVSGLEYFEKIRTFLGGASREDLRALSQHNVSMDIATFKKLQVDALVGLSVAEVQKLLGPHIGDLKTEEDKSPVRDWLFRQQQKDLDSLGLGLQGGIPNGYLILDFNVREAFS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal His-tagged/Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Membrane-anchored forms may play a role in cellular adhesion.; Megakaryocyte-potentiating factor (MPF) may potentiate megakaryocyte colony formation.
Gene References into Functions
  1. Mesothelin may have an important role in the remodeling of the endocrine pancreas in neonatal rats. PMID:24944479
  2. Megakaryocyte potentiating factor is a useful serum biomarker for the effects of chrysotile exposure on respiratory organs. PMID:20933535
  3. Mesothelin might be involved in some developmental events during development of rat pancreas. PMID:18505465

Show More

Hide All

Subcellular Location
Cell membrane; Lipid-anchor, GPI-anchor. Golgi apparatus.; [Megakaryocyte-potentiating factor]: Secreted.
Protein Families
Mesothelin family
Tissue Specificity
Specifically expressed in lung. Overexpressed in hereditary renal carcinoma developed by Eker rats.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1