Recombinant Rat Mesothelin (Msln)

Code
MSDS	MSDS Datasheet
Size	Pls inquire
Source
Conjugate
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Abbreviation

Msln

Purity

>85% (SDS-PAGE)

Target Names

Msln

Uniprot NO.

Q9ERA7

Species

Rattus norvegicus (Rat)

Source

Yeast

Expression Region

298-600

Target Protein Sequence

DTEQKACPPGKEPNVVDENLIFYQNWELEACVDGTLLAGQMDLVNEIPFTYEQLSIFKHKLDKTYPQGYPESLIKQLGHFFRYVSPEDIRQWNVTSPDTVNTLLKVSKGQKMDAQVIALVACYLRGGGKLDEDIVKALDNIPLSYLCDFSPQDLHAIPSSVMWLVGLHDLDKCSQRHLGILYQKACSAFQNVSGLEYFEKIRTFLGGASREDLRALSQHNVSMDIATFKKLQVDALVGLSVAEVQKLLGPHIGDLKTEEDKSPVRDWLFRQQQKDLDSLGLGLQGGIPNGYLILDFNVREAFS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal His-tagged/Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Shelf Life

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Membrane-anchored forms may play a role in cellular adhesion.; Megakaryocyte-potentiating factor (MPF) may potentiate megakaryocyte colony formation.

Gene References into Functions

Mesothelin may have an important role in the remodeling of the endocrine pancreas in neonatal rats. PMID:24944479
Megakaryocyte potentiating factor is a useful serum biomarker for the effects of chrysotile exposure on respiratory organs. PMID:20933535
Mesothelin might be involved in some developmental events during development of rat pancreas. PMID:18505465

Hide All

Subcellular Location

Cell membrane; Lipid-anchor, GPI-anchor. Golgi apparatus.; [Megakaryocyte-potentiating factor]: Secreted.

Protein Families

Mesothelin family

Tissue Specificity

Specifically expressed in lung. Overexpressed in hereditary renal carcinoma developed by Eker rats.

Database Links

UNIGENE: Rn.18607

KEGG: rno:60333

STRING: 10116.ENSRNOP00000026395

Promotions