Recombinant Rat Interleukin-33 (Il33), partial

Code
MSDS	MSDS Datasheet
Size	Pls inquire
Source
Conjugate
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Abbreviation

Il33

Purity

>85% (SDS-PAGE)

Target Names

Il33

Uniprot NO.

Q66H70

Species

Rattus norvegicus (Rat)

Source

Yeast

Expression Region

102-264aa

Target Protein Sequence

AASVDTLSIQGTSLLTESCALSTYNDQSVSFVLENGCYVINVEDCGKNQEKDKVLLRYYESSFPAQSGDGVDGKKLMVNMSPIKDTDIWLNANDKDYSVELQKGDVSPPDQAFFVLHKKSSDFVSFECKNLPGTYIGVKDNQLALVEENDESCNNIMFKLSKM
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

Partial

Tag Info

N-terminal His-tagged/Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Buffer

Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Storage

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Shelf Life

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Cytokine that binds to and signals through the IL1RL1/ST2 receptor which in turn activates NF-kappa-B and MAPK signaling pathways in target cells. Involved in the maturation of Th2 cells inducing the secretion of T-helper type 2-associated cytokines. Also involved in activation of mast cells, basophils, eosinophils and natural killer cells. Acts as a chemoattractant for Th2 cells, and may function as an 'alarmin', that amplifies immune responses during tissue injury.; In quiescent endothelia the uncleaved form is constitutively and abundantly expressed, and acts as a chromatin-associated nuclear factor with transcriptional repressor properties, it may sequester nuclear NF-kappaB/RELA, lowering expression of its targets. This form is rapidely lost upon angiogenic or proinflammatory activation.

Gene References into Functions

The release of IL-33 from necrotic cells might induce autophagy, which can further balance the effects of increased apoptosis secondary to contrast-induced nephropathy in diabetic kidney disease. PMID:27055881
TNF-alpha stimulated IL-33/sST2 and subsequent increase of IL-6 may be the mechanism of IL-33 in acute pancreatitis. PMID:26927343
poly-IC and IL-33 play a role in myelin repair by enhancing expression of myelin genes. PMID:27022724
IL-33 protects against myocardial I/R injury by inhibiting inflammatory responses and myocardial apoptosis. PMID:26571038
These findings indicate that IL-33 might play an important role in the inflammatory response following subarachnoid hemorrhage. PMID:25417195
MRAs play a pivotal role in the Gal-3 and IL-33/ST2 modulation in post-MI cardiac remodeling. PMID:25458175
Induced interleukin-33 expression enhances the tumorigenic activity of rat glioma cells. PMID:24327583
Data indicate IL-33 concentration was increased in the pancreas in duct ligation-induced acute pancreatitis. PMID:23418608
The effects of external application of IL1beta and IL33 on the cardiomyocyte transcriptome, were compared. PMID:23219998
This study examined the expression of IL-33 and the IL-33-mediated regulation of cell functions in pancreatic stellate cells isolated from human and rat pancreas tissues. PMID:20689058