Recombinant Rat Interleukin-13 (Il13)

Code
MSDS	MSDS Datasheet
Size	Pls inquire
Source
Conjugate
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

>85% (SDS-PAGE)

Target Names

Il13

Uniprot NO.

P42203

Alternative Names

Il13; Il-13; Interleukin-13; IL-13; T-cell activation protein P600

Species

Rattus norvegicus (Rat)

Source

Yeast

Expression Region

19-131aa

Target Protein Sequence

TPGPVRRSTSPPVALRELIEELSNITQDQKTSLCNSSMVWSVDLTAGGFCAALESLTNISSCNAIHRTQRILNGLCNQKASDVASSPPDTKIEVAQFISKLLNYSKQLFRYGH
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal His-tagged/Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Buffer

Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Storage Condition

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Shelf Life

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Cytokine. Inhibits inflammatory cytokine production. Synergizes with IL2 in regulating interferon-gamma synthesis. May be critical in regulating inflammatory and immune responses. Positively regulates IL31RA expression in macrophages.

Gene References into Functions

SUMF2 may mediate airway inflammation in allergic asthma by modulating the expression of IL-13 PMID:26722390
IL-13 significantly enhanced C/EBP-alpha/COX-2 expression and PGE2 production in LPS-treated microglial cells. Paradoxically, IL-13 abolished C/EBP-beta/PPAR-gamma/HO-1 expression. PMID:23881867
asthma the ERK expression and activation levels were increased, as was the protein level of IL-13. The ERK signaling pathway may be involved in the increased expression of the Th2 cytokine IL-13 in asthma. PMID:20819635
The IL-13 system is a novel regulator of paSMC growth. Dysregulation of IL-13 receptor expression in IPAH may partially underlie smooth muscle hypertrophy associated with pathological vascular remodeling in IPAH. PMID:20522789
IL-13 is involved in tobacco smoke-induced changes in the structure and function of rat intrapulmonary airways PMID:19783789
This finding provides an unequivocal evidence of IL-13 participation in pancreatic fibrosis, illustrating a new strategy for chronic pancreatitis. PMID:20100461
Inhibition of HO-1 with tin protoporphyrin reversed cytoprotective/antiapoptotic effects of IL-13 in liver transplantation. PMID:12919086
IL-13 may control brain inflammation by inducing the death of activated microglia in vivo, resulting in an enhancement of neuronal survival. PMID:15042582
study demonstrated at the protein and mRNA levels, both in vivo and in vitro, that alveolar macrophages produce IL-25 and IL-13 in response to fine particles of TiO2 PMID:15961726
IL-13 overexpression in the rat could lead to podocyte injury and minimal-change-like nephropathy. PMID:17429054
The findings support a role for IL-13 as an in vivo antiangiogenic factor and provide a rationale for its use in RA to control. pathologic neovascularization. PMID:17665443
IL-13 down-regulates the cytokine-induced iNOS transcription by decreasing iNOS specific IRF-1/ISRE binding activity PMID:17723228
expression decreased in lung in response to alcohol exposure PMID:19120067
Endogenous IL-13 triggers microglial NADPH oxidase-derived oxidative stress, leading to degeneration of hippocampal neurons in vivo. PMID:19752235