Recombinant Rat Interferon gamma (Ifng)

Code: CSB-YP011050RA
Size:
20ug
20ug100ug1mg
US$368
Quantity:
Express system: Yeast
Species: Rattus norvegicus (Rat)
Tag Info: N-terminal 6xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Abbreviation
Recombinant Rat Ifng protein
Purity
Greater than 95% as determined by SDS-PAGE.
Greater than 95% as determined by SEC-HPLC.
Activity
Not Test
Target Names
Ifng
Uniprot NO.
Research Area
Others
Species
Rattus norvegicus (Rat)
Source
Yeast
Expression Region
23-156aa
Target Protein Sequence
QGTLIESLESLKNYFNSSSMDAMEGKSLLLDIWRNWQKDGNTKILESQIISFYLRLFEVLKDNQAISNNISVIESHLITNFFSNSKAKKDAFMSIAKFEVNNPQIQHKAVNELIRVIHQLSPESSLRKRKRSRC
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
17.0 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • The purity of Ifng was greater than 95% as determined by SEC-HPLC

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Type II interferon produced by immune cells such as T-cells and NK cells that plays crucial roles in antimicrobial, antiviral, and antitumor responses by activating effector immune cells and enhancing antigen presentation. Primarily signals through the JAK-STAT pathway after interaction with its receptor IFNGR1 to affect gene regulation. Upon IFNG binding, IFNGR1 intracellular domain opens out to allow association of downstream signaling components JAK2, JAK1 and STAT1, leading to STAT1 activation, nuclear translocation and transcription of IFNG-regulated genes. Many of the induced genes are transcription factors such as IRF1 that are able to further drive regulation of a next wave of transcription. Plays a role in class I antigen presentation pathway by inducing a replacement of catalytic proteasome subunits with immunoproteasome subunits. In turn, increases the quantity, quality, and repertoire of peptides for class I MHC loading. Increases the efficiency of peptide generation also by inducing the expression of activator PA28 that associates with the proteasome and alters its proteolytic cleavage preference. Up-regulates as well MHC II complexes on the cell surface by promoting expression of several key molecules such as cathepsins B/CTSB, H/CTSH, and L/CTSL. Participates in the regulation of hematopoietic stem cells during development and under homeostatic conditions by affecting their development, quiescence, and differentiation.
Gene References into Functions
  1. Lipopolysaccharide enhances TLR4 expression in rat pulmonary artery smooth muscle cells and induced production of IFNgamma dramatically. PMID:28714001
  2. This study suggested that IFN-gamma maintained tolerance mediating alloantigen-specific CD4(+)CD25(+)T cells. PMID:28487237
  3. Addition of 20 (3) and 40 (6) mg/L (mg/kg BW) of boron to drinking water significantly increased rat serum IgG concentrations, splenic IFN-gamma and IL-4 expression as well as the number of splenic CD3(+), CD4(+) and proliferating cell nuclear antigen (PCNA)(+) cells. PMID:28092075
  4. The results provide evidence that changes in IFN-gamma expression and signalling may be perceived at stages preceding refractory cachexia, and therefore, might be employed as a means to assess the early stage of the syndrome PMID:26987263
  5. This study found that ACZ could decrease the content of pro-inflammatory cytokines, such as MCP-1, IL-1beta, TNF-alpha and IFN-gamma in rat lungs, and, the lung injury in the HA+ACZ group reduced. PMID:27104804
  6. IFN-gamma dose-dependently induces HMGB1 cytoplasmic accumulation and its active release from VSMCs, resulting in enhanced HMGB1 in the medium. PMID:27579780
  7. The results thus demonstrate that XO mediates oxidative stress in MB+PQ-treated rat PMNs via iNOS-independent but cytokine (predominantly IFN-gamma)-dependent mechanism. PMID:28025796
  8. Iba-1-immunoreactive microglia are activated and IFN-gamma and IL-1beta levels are increased in the hippocampal CA1 region and the dentate gyrus of aged, diabetic rats, indicating that chronic diabetes may accelerate aging processes in the hippocampus PMID:24571083
  9. The findings of the present study suggest that part of ischemic injury in the embolic stroke may be mediated through the increased levels of inflammatory cytokines. PMID:24338258
  10. Apoptotic cell death assessed by TUNEL assay was enhanced in both ERalpha and ERbeta-silenced VSC4.1 motoneurons following IFN-gamma and IGF-1 exposure. PMID:24188094
  11. The interleukin (IL)-18/IFN-gamma system may be involved in status epilepticus-induced vasogenic edema formation. PMID:22338606
  12. IFNgamma produced by constituents of the mucosal immune system modulates epithelial cell functions with relevance for intestinal wound healing and may play a role in preserving the integrity of the intestinal epithelium following various forms of injuries. PMID:21385594
  13. Furthermore, IFNgamma reduced JNK phosphorylation, which tightly was associated with decreased phosphorylation of downstream factors c-Jun and Smad3 and decreased binding activity of c-Jun and Smad3 in the preprpET-1 promoter. PMID:22301113
  14. Study provides mechanistic insights in the IFN-mediated suppression of ICP4 and IE180 in sensory neuronal cells. PMID:21641126
  15. Garlicin could increase the level of INF-gamma and decrease the level of IL4 significantly in allergic rhinitis. PMID:18826099
  16. IFN-gamma is able to activate rat intestinal mucous microvascular endothelial cells, thereby leading to upregulated expressions of IFN-alpha/beta. PMID:20214528
  17. IFN-gamma enhanced IL-27 secretion, revealing a cooperative interplay between the two cytokines. PMID:21123181
  18. Immunoregulatory cytokines belonging to the Th-1 group (IL-2 and IFN-gamma) were increased in the retina of experimental diabetic rats PMID:20213480
  19. The interplay between IFNgamma released from immune cells and PACAP is of importance in brain inflammation and may affect the regeneration and recruitment of NPCs in immune diseases PMID:20559421
  20. Fasting-induced iNOS activation in epithelial cells may induce apoptosis mediatiors such as interferon-gamma via a reactive oxyge speces-mediated mechanism. PMID:20378828
  21. Data show that IgG stimulation induced a significant TLR4 expression and TNF-alpha secretion in cultured microglial cells in a dose-dependent manner, while IFN-gamma was PMID:19257980
  22. Data show that treated rats exhibited the lowest degree of inflammatory infiltration of the spinal cord, as well as the lowest levels of nuclear factor kappa B, interleukin-12 and interferon-gamma. PMID:19922500
  23. Data show that methylprednisolone inhibited IFN-gamma and IL-17 expression and production in cells isolated from the CNS of rats with experimental autoimmune encephalomyelitis. PMID:20003332
  24. role of IFN-gamma in the regulation of bacterial load in the cecal ligation and puncture (CLP) model of intra-abdominal sepsis in the rat PMID:11770039
  25. Interferon-gamma significantly inhibits hepatic stellate cell proliferation and reduces smooth muscle alpha-actin abundance after 6 days treatment. PMID:11940252
  26. the spleen contributes to the endotoxin-induced liver injury by modulating release of IFNgamma PMID:11954833
  27. IFN-gamma increased mRNA activity and gene expression of TGase 2 in a rat small intestinal epithelial cell line. PMID:12162878
  28. IFN-gamma inhibited TGF-beta(1)-induced increases in PG expression by fibroblasts in fibrotic lungs. PMID:12225958
  29. Increased levels in BALF of anti-IP-10 antibody-treated F344 rats following Sendai viral infection. PMID:12581489
  30. role in post-translational regulation of Muc4 PMID:12668667
  31. plays an important physiological role during inflammation by down-regulating collagen gene expression and activating major histocompatibility II complex PMID:12968017
  32. Differential signaling through IFN-gamma in the conjunctiva between the Lewis and Brown Norway rat strains in experimental allergic conjunctivitis. This may be due to differences in histopathological character between the two strains. PMID:14605445
  33. The protein level of IFN-gamma follows a physiological circadian rhythm in rat splenocytes that concurrently drives the circadian rhythm of natural killer cell cytolytic activity. PMID:14978081
  34. IFN-gamma induces rapid secretion of macrophage migration inhibitory factor by renal tubular epithelial cells. PMID:15012733
  35. JNK signaling plays an important role in the inhibitory effects of cAMP on IL-1beta+IFNgamma-induced iNOS gene expression in cultured hepatocytes PMID:15115662
  36. Taken together, these results suggest that NDGA regulates IFN-gamma-mediated inflammation through mechanisms unrelated to the inhibition of 5-LO PMID:15694390
  37. retinoic acid induces an anti-inflammatory effect by suppressing the activation of the JAK/STAT pathway in IFN-gamma-treated astrocytes PMID:15721283
  38. IFN-gamma, in conjunction with TNF or LPS, can both inhibit hepatocyte proliferation through the generation of nitric oxide and stimulate oval cell replication. PMID:15799032
  39. Circadian expression of interferon gamma mRNA is demonstrated for the first time in natural killer (NK) cells enriched from rat spleen. PMID:15944262
  40. IFN-gamma can modulate the expression of RT1A and RT1-DM during the whole pregnancy PMID:15946996
  41. IFN-gamma in NK cells has a role in the link between the innate and adaptive immune responses early after transplantation PMID:16095488
  42. The leukemia inhibitory factor inhibition of interferon-gamma toxicity in oligodendrocytes is mediated by a suppressor of cytokine signaling-3 independent mechanism. PMID:16289836
  43. The evidence presented suggests that IGF-1 acts to antagonize the IFNgamma-induced microglial activation, the accompanying increase in IL-1beta concentration and the consequent deficit in LTP. PMID:16464236
  44. Intermittent fasting dietary restriction stimulates IFN-gamma-mediated neuroprotective signaling in the hippocampus, suggesting a role for this cytokine in neural cytoprotection. PMID:16521127
  45. Astrocytes up-regulated IFN-gamma gene expression and protein synthesis in T cells, which coincided with astrocytes' ability to express IL-23 subunit p19 and common IL-12/IL-23 subunit p40. PMID:17969033
  46. the primary effect of atorvastatin is to increase IL-4, which antagonizes the effects of IFNgamma, the associated increase in microglial activation, and the subsequent cascade of events. PMID:17981803
  47. Innate immunity (natural killer cells/IFN-gamma) is activated after allogeneic transplantation, which likely contributes to liver injury and inhibits hepatocyte proliferation. PMID:18292182
  48. Data suggest that estradiol effects on T cell IFN-gamma and IL-2 production afer trauma-hemorrhage are mediated via non-genomic pathway, and which is in turn mediated via ERK, p38, and JNK pathways. PMID:18343154
  49. The aim of this study was to evaluate the constitutive expression of IL-18 and its receptors (IL-18Ralpha and IL-18Rbeta) in intestinal epithelial cells (IEC) stimulated by tumor necrosis factor-alpha (TNF-alpha) and interferon-gamma (IFN-gamma). PMID:18547159
  50. An enhanced integrated stress response could promote oligodendrocyte survival in immune-mediated demyelination diseases. PMID:18818381

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
Type II (or gamma) interferon family
Tissue Specificity
Released primarily from activated T lymphocytes.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products