Recombinant Rat Frataxin, mitochondrial (Fxn)

In Stock

Code: CSB-EP009086RAe1

Rate （N/A）
Review （0）

Size:

20μg100μg1mg(1mg*1 or 500ug*2)

US$472

Quantity:

Express system: E.coli

Species: Rattus norvegicus (Rat)

Tag Info: Tag-Free

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

Fxn

Uniprot NO.

D3ZYW7

Research Area

Tags & Cell Markers

Species

Rattus norvegicus (Rat)

Source

E.coli

Expression Region

41-208aa

Target Protein Sequence

LHVTANADAIRHSHLNLHYLGQILNIKKQSVCVVHLRNSGTLGNPSSLDETAYERLAEETLDALAEFFEDLADKPYTLKDYDVSFGDGVLTIKLGGDLGTYVINKQTPLLYLWFSGPCSGPKRYDWTGKNWVYSHDGVSLHELLARELTEALNTKLDLSSLAYSGKGT
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

18.6kDa

Protein Length

Full Length of Mature Protein

Tag Info

Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

■ Q&A

We have a question about one of your products:
Has the Recombinant Rat Frataxin protein CSB-EP009086RAe1 ever been tested in Western blot or is it only tested in SDS-PAGE?

Thanks for your inquiry. Regarding this item, CSB-EP009086RAe1, it is only tested in SDS-PAGE currently. But we could run WB test and show the result in CoA report, if you request. Lead time will be extended extra 3 business days for WB.

Target Background

Function(From Uniprot)

Promotes the biosynthesis of heme and assembly and repair of iron-sulfur clusters by delivering Fe(2+) to proteins involved in these pathways. May play a role in the protection against iron-catalyzed oxidative stress through its ability to catalyze the oxidation of Fe(2+) to Fe(3+); the oligomeric form but not the monomeric form has in vitro ferroxidase activity. May be able to store large amounts of iron in the form of a ferrihydrite mineral by oligomerization. Modulates the RNA-binding activity of ACO1.

Subcellular Location

Cytoplasm, cytosol. Mitochondrion.

Protein Families

Frataxin family

Database Links

UNIGENE: Rn.13133

Promotions